KEGG   Homo sapiens (human): 9554Help
Entry
9554              CDS       T01001                                 

Gene name
SEC22B, ERS-24, SEC22L1
Definition
SEC22 vesicle trafficking protein homolog B (S. cerevisiae) (gene/pseudogene)
Orthology
K08517  
vesicle transport protein SEC22
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Phagosome
Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9554 (SEC22B)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    9554 (SEC22B)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    9554 (SEC22B)
SNAREs [BR:hsa04131]
 VAMP, Ykt6, Sec22 (R)
  Sec22
   9554 (SEC22B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 215 aa AA seqDB search
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctaacaatgatcgcccgagtggcggacgggctcccgctggccgcctcgatg
caggaggacgaacagtctggccgggaccttcaacaatatcagagtcaggctaagcaactc
tttcgaaagttgaatgaacagtcccctaccagatgtaccttggaagcaggagccatgact
tttcactacattattgagcagggggtgtgttatttggttttatgtgaagctgccttccct
aagaagttggcttttgcctacctagaagatttgcactcagaatttgatgaacagcatgga
aagaaggtgcccactgtgtcccgaccctattcctttattgaatttgatactttcattcag
aaaaccaagaagctctacattgacagtcgtgctcgaagaaatctaggctccatcaacact
gaattgcaagatgtgcagaggatcatggtggccaatattgaagaagtgttacaacgagga
gaagcactctcagcattggattcaaaggctaacaatttgtccagtctgtccaagaaatac
cgccaggatgcgaagtacttgaacatgcgttccacttatgccaaacttgcagcagtagct
gtatttttcatcatgttaatagtgtatgtccgattctggtggctgtga

DBGET integrated database retrieval system