KEGG   Homo sapiens (human): 9554Help
Entry
9554              CDS       T01001                                 

Gene name
SEC22B, ERS-24, SEC22L1
Definition
SEC22 vesicle trafficking protein homolog B (S. cerevisiae) (gene/pseudogene)
Orthology
K08517  
vesicle transport protein SEC22
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Phagosome
Legionellosis
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 215 aa AA seqDB search
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctaacaatgatcgcccgagtggcggacgggctcccgctggccgcctcgatg
caggaggacgaacagtctggccgggaccttcaacaatatcagagtcaggctaagcaactc
tttcgaaagttgaatgaacagtcccctaccagatgtaccttggaagcaggagccatgact
tttcactacattattgagcagggggtgtgttatttggttttatgtgaagctgccttccct
aagaagttggcttttgcctacctagaagatttgcactcagaatttgatgaacagcatgga
aagaaggtgcccactgtgtcccgaccctattcctttattgaatttgatactttcattcag
aaaaccaagaagctctacattgacagtcgtgctcgaagaaatctaggctccatcaacact
gaattgcaagatgtgcagaggatcatggtggccaatattgaagaagtgttacaacgagga
gaagcactctcagcattggattcaaaggctaacaatttgtccagtctgtccaagaaatac
cgccaggatgcgaagtacttgaacatgcgttccacttatgccaaacttgcagcagtagct
gtatttttcatcatgttaatagtgtatgtccgattctggtggctgtga

DBGET integrated database retrieval system