KEGG   Homo sapiens (human): 9560Help
Entry
9560              CDS       T01001                                 

Gene name
CCL4L1, AT744.2, CCL4L, LAG-1, LAG1, SCYA4L
Definition
chemokine (C-C motif) ligand 4-like 1
Orthology
K12964  
C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Salmonella infection
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q12
AA seq 92 aa AA seqDB search
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRGKQVCADPSESWVQEYVYDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcgtgctagtagctgccttctgctctcta
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaagaggcaagcaagtctgcgctgaccccagtgagtcc
tgggtccaggagtacgtgtatgacctggaactgaactga

DBGET integrated database retrieval system