KEGG   Homo sapiens (human): 9563Help
Entry
9563              CDS       T01001                                 

Gene name
H6PD, CORTRD1, G6PDH, GDH
Definition
(RefSeq) hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase (EC:1.1.1.47 3.1.1.31)
  KO
K13937  
hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Disease
H01111  
Cortisone reductase deficiency (CRD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    9563 (H6PD)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    9563 (H6PD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     9563 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     9563 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36
AA seq 791 aa AA seqDB search
MWNMLIVAMCLALLGCLQAQELQGHVSIILLGATGDLAKKYLWQGLFQLYLDEAGRGHSF
SFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQAL
NKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIARNINSSCRPGPGAWLRVVLEKPFGHDH
FSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLWNRHHVERVEII
MKETVDAEGRTSFYEEYGVIRDVLQNHLTEVLTLVAMELPHNVSSAEAVLRHKLQVFQAL
RGLQRGSAVVGQYQSYSEQVRRELQKPDSFHSLTPTFAAVLVHIDNLRWEGVPFILMSGK
ALDERVGYARILFKNQACCVQSEKHWAAAQSQCLPRQLVFHIGHGDLGSPAVLVSRNLFR
PSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLL
ASWNFWTPLLESLAHKAPRLYPGGAENGRLLDFEFSSGRLFFSQQQPEQLVPGPGPAPMP
SDFQVLRAKYRESPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQ
QLATAHYGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRIPYYNIHPMPVHLQQ
RLCAEEDQGAQIYAREISALVANSSFDLVLLGMGADGHTASLFPQSPTGLDGEQLVVLTT
SPSQPHRRMSLSLPLINRAKKVAVLVMGRMKREITTLVSRVGHEPKKWPISGVLPHSGQL
VWYMDYDAFLG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatatgctcatagtggcgatgtgcttggcccttctgggctgcctgcaagcccag
gagctccagggacatgtctccataatcctgctgggagcaactggggacctggctaagaag
tacttatggcagggactgttccagctgtacctggatgaagcggggaggggtcacagtttt
agcttccatggagctgctctgacagcccccaagcagggtcaagagctcatggccaaggcc
ctggaatccctctcctgccccaaggacatggcacccagtcactgtgcagagcacaaggat
cagttcctgcagctgagccagtaccgccaactgaagacggccgaggactatcaggccctg
aacaaggacatcgaggcacagctccagcacgcaggcctccgggaggctggcaggatcttc
tacttctcagtgccacccttcgcctatgaagacattgcccgcaacatcaacagtagctgc
cggccaggcccgggcgcctggctgcgggttgtccttgagaaaccctttggccatgaccac
ttctcagcccagcagctggccacagaactcgggacctttttccaggaggaggagatgtac
cgggtggaccattacttaggcaagcaggctgtggcgcagatcctgcctttccgagaccag
aaccgcaaggctttggacggcctctggaaccggcaccatgtggagcgggtggagatcatc
atgaaagagaccgtggatgctgaaggccgcaccagcttctatgaggagtacggtgtcatt
cgcgacgtcctccagaaccatctgacggaggtcctcaccctcgtggccatggagctgccc
cacaatgtcagcagtgcggaggctgtgctgcggcacaagcttcaggtcttccaggcgctg
cggggcctgcagaggggcagtgccgtcgtgggccagtaccagtcttacagtgagcaggtg
cgcagagagctgcagaagccagacagcttccacagcctgacgccgaccttcgcagccgtc
ctagtgcacattgacaaccttcgctgggagggcgtgcctttcatcctgatgtctggcaaa
gccttggacgagagagtgggctacgctcggatcttgttcaagaaccaggcctgctgtgtg
cagagcgaaaagcactgggccgcggcgcagagccagtgcctgccccggcagctcgtcttc
cacatcggccatggcgacctgggcagccctgccgtgctggtcagcaggaacctgttcagg
ccctccctgccctccagctggaaggaaatggagggaccacctgggctccgccttttcggc
agccctctgtccgattactacgcctacagccctgtgcgggagcgggacgcccactccgtc
ctcttatcccatatcttccatggccggaagaatttcttcatcaccacagagaacttgctg
gcctcctggaacttctggacccctctgctggagagcctggcccataaggccccacgcctc
taccctggaggagctgagaatggccgtctgttggactttgagttcagtagcggccggttg
ttcttttcccagcagcagccggagcagctggtgccagggccagggccggccccaatgccc
agtgacttccaggtcctcagggccaagtaccgagagagcccgctggtctccgcctggtcc
gaggagctgatctctaagctggctaatgacatcgaggccaccgctgtgcgagccgtgcgg
cgctttggccagttccacctggcactgtcggggggctcgagccccgtggccctgttccag
cagctggccacggcgcactatggcttcccctgggcccacacgcacctgtggctggttgac
gagcgctgcgtcccactctcagacccggagtccaacttccagggcctgcaggcccacctg
ctgcagcacgtccggatcccctactacaacatccaccccatgcctgtgcacctgcagcag
cggctctgcgccgaggaggaccagggcgcccagatctatgccagggagatctcagccctg
gtggccaacagcagcttcgacctggtgctgctgggcatgggtgccgacgggcacacagcc
tccctcttcccacagtcacccactggcctggatggcgagcagctggtcgtgctgaccacg
agcccctcccagccacaccgccgcatgagccttagcctgcctctcatcaaccgcgccaag
aaggtggcagtcctggtcatgggcaggatgaagcgtgagatcaccacgctggtgagccgg
gtgggccatgagcccaagaagtggcccatctcgggtgtcctgccgcactccggccagctg
gtgtggtacatggactacgacgccttcctgggatga

DBGET integrated database retrieval system