KEGG   Homo sapiens (human): 9568Help
Entry
9568              CDS       T01001                                 

Gene name
GABBR2, GABABR2, GPR51, GPRC3B, HG20, HRIHFB2099
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 2
  KO
K04615  
gamma-aminobutyric acid type B receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
GABAergic synapse
Taste transduction
Estrogen signaling pathway
Morphine addiction
Drug target
Aminobutyric acid: 
Arbaclofen (DG01354): 
Baclofen: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    9568 (GABBR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9568 (GABBR2)
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    9568 (GABBR2)
  Nervous system
   04727 GABAergic synapse
    9568 (GABBR2)
  Sensory system
   04742 Taste transduction
    9568 (GABBR2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    9568 (GABBR2)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   GABA
    9568 (GABBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.1-q22.3
AA seq 941 aa AA seqDB search
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH
HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgcggagctccgggcagcccgggccgccgccgccgccgccaccgccgccc
gcgcgcctgctactgctactgctgctgccgctgctgctgcctctggcgcccggggcctgg
ggctgggcgcggggcgccccccggccgccgcccagcagcccgccgctctccatcatgggc
ctcatgccgctcaccaaggaggtggccaagggcagcatcgggcgcggtgtgctccccgcc
gtggaactggccatcgagcagatccgcaacgagtcactcctgcgcccctacttcctcgac
ctgcggctctatgacacggagtgcgacaacgcaaaagggttgaaagccttctacgatgca
ataaaatacgggcctaaccacttgatggtgtttggaggcgtctgtccatccgtcacatcc
atcattgcagagtccctccaaggctggaatctggtgcagctttcttttgctgcaaccacg
cctgttctagccgataagaaaaaatacccttatttctttcggaccgtcccatcagacaat
gcggtgaatccagccattctgaagttgctcaagcactaccagtggaagcgcgtgggcacg
ctgacgcaagacgttcagaggttctctgaggtgcggaatgacctgactggagttctgtat
ggcgaggacattgagatttcagacaccgagagcttctccaacgatccctgtaccagtgtc
aaaaagctgaaggggaatgatgtgcggatcatccttggccagtttgaccagaatatggca
gcaaaagtgttctgttgtgcatacgaggagaacatgtatggtagtaaatatcagtggatc
attccgggctggtacgagccttcttggtgggagcaggtgcacacggaagccaactcatcc
cgctgcctccggaagaatctgcttgctgccatggagggctacattggcgtggatttcgag
cccctgagctccaagcagatcaagaccatctcaggaaagactccacagcagtatgagaga
gagtacaacaacaagcggtcaggcgtggggcccagcaagttccacgggtacgcctacgat
ggcatctgggtcatcgccaagacactgcagagggccatggagacactgcatgccagcagc
cggcaccagcggatccaggacttcaactacacggaccacacgctgggcaggatcatcctc
aatgccatgaacgagaccaacttcttcggggtcacgggtcaagttgtattccggaatggg
gagagaatggggaccattaaatttactcaatttcaagacagcagggaggtgaaggtggga
gagtacaacgctgtggccgacacactggagatcatcaatgacaccatcaggttccaagga
tccgaaccaccaaaagacaagaccatcatcctggagcagctgcggaagatctccctacct
ctctacagcatcctctctgccctcaccatcctcgggatgatcatggccagtgcttttctc
ttcttcaacatcaagaaccggaatcagaagctcataaagatgtcgagtccatacatgaac
aaccttatcatccttggagggatgctctcctatgcttccatatttctctttggccttgat
ggatcctttgtctctgaaaagacctttgaaacactttgcaccgtcaggacctggattctc
accgtgggctacacgaccgcttttggggccatgtttgcaaagacctggagagtccacgcc
atcttcaaaaatgtgaaaatgaagaagaagatcatcaaggaccagaaactgcttgtgatc
gtggggggcatgctgctgatcgacctgtgtatcctgatctgctggcaggctgtggacccc
ctgcgaaggacagtggagaagtacagcatggagccggacccagcaggacgggatatctcc
atccgccctctcctggagcactgtgagaacacccatatgaccatctggcttggcatcgtc
tatgcctacaagggacttctcatgttgttcggttgtttcttagcttgggagacccgcaac
gtcagcatccccgcactcaacgacagcaagtacatcgggatgagtgtctacaacgtgggg
atcatgtgcatcatcggggccgctgtctccttcctgacccgggaccagcccaatgtgcag
ttctgcatcgtggctctggtcatcatcttctgcagcaccatcaccctctgcctggtattc
gtgccgaagctcatcaccctgagaacaaacccagatgcagcaacgcagaacaggcgattc
cagttcactcagaatcagaagaaagaagattctaaaacgtccacctcggtcaccagtgtg
aaccaagccagcacatcccgcctggagggcctacagtcagaaaaccatcgcctgcgaatg
aagatcacagagctggataaagacttggaagaggtcaccatgcagctgcaggacacacca
gaaaagaccacctacattaaacagaaccactaccaagagctcaatgacatcctcaacctg
ggaaacttcactgagagcacagatggaggaaaggccattttaaaaaatcacctcgatcaa
aatccccagctacagtggaacacaacagagccctctcgaacatgcaaagatcctatagaa
gatataaactctccagaacacatccagcgtcggctgtccctccagctccccatcctccac
cacgcctacctcccatccatcggaggcgtggacgccagctgtgtcagcccctgcgtcagc
cccaccgccagcccccgccacagacatgtgccaccctccttccgagtcatggtctcgggc
ctgtaa

DBGET integrated database retrieval system