KEGG   Homo sapiens (human): 9586Help
Entry
9586              CDS       T01001                                 

Gene name
CREB5, CRE-BPA
Definition
cAMP responsive element binding protein 5
Orthology
K09047  
cyclic AMP-responsive element-binding protein 5
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Viral carcinogenesis
Prostate cancer
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15.1
AA seq 369 aa AA seqDB search
MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPME
RQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMM
EMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSH
LHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRR
KFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHK
DCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTT
HRTDLNPIL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcacctcaggagggaattcagcctcagtgatgtccatgaggcctgtcccaggc
tctctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatg
cctgggaccctgcccaaccctacaatgccaggatcttccgccgtcttgatgccaatggag
cgacaaatgtcagtgaactccagcatcatggggatgcaaggtccaaatctcagcaacccc
tgtgcttctccccaggtccagccaatgcattcagaagccaaaatgaggttgaaggctgca
ttgactcaccaccctgctgccatgtcaaatgggaacatgaacaccatgggacacatgatg
gagatgatgggctcccggcaggaccagacgccacaccatcacatgcactcgcacccgcat
cagcaccagacactgccaccccatcacccttacccacaccagcaccagcacccagcacac
catcctcaccctcaaccccatcaccagcagaaccatccacatcaccactcccattcccac
cttcatgcacacccagcacatcaccagacctcgccacatccgcccctgcacaccggcaac
caagcacaggtttcaccagcaacacaacagatgcagccaacccagacaatacagccaccc
cagcccacaggggggcgccggcgaagggtggtagacgaggatccggacgagaggcggcgg
aaatttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgg
gtgatgtcattggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaat
gaagtgtctatgttgaaaaatgaggtggcccagctgaaacagttgttgttaacacataaa
gactgcccaataacagccatgcagaaagaatcacaaggatatctaagtccagagagtagc
cctcctgctagtcctgtcccagcttgctcccagcaacaagtcatccagcataataccatc
actacttcctcatcggtcagcgaggtggtaggaagctccaccctcagccagctcaccact
cacagaacagacctgaatccgattctttaa

DBGET integrated database retrieval system