KEGG   Homo sapiens (human): 9586Help
Entry
9586              CDS       T01001                                 

Gene name
CREB5, CRE-BPA
Definition
cAMP responsive element binding protein 5
Orthology
K09047  
cyclic AMP-responsive element-binding protein 5
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    9586 (CREB5)
   04022 cGMP - PKG signaling pathway
    9586 (CREB5)
   04151 PI3K-Akt signaling pathway
    9586 (CREB5)
   04152 AMPK signaling pathway
    9586 (CREB5)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    9586 (CREB5)
   04915 Estrogen signaling pathway
    9586 (CREB5)
   04918 Thyroid hormone synthesis
    9586 (CREB5)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    9586 (CREB5)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    9586 (CREB5)
  Nervous system
   04725 Cholinergic synapse
    9586 (CREB5)
   04728 Dopaminergic synapse
    9586 (CREB5)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9586 (CREB5)
   05215 Prostate cancer
    9586 (CREB5)
  Neurodegenerative diseases
   05016 Huntington's disease
    9586 (CREB5)
  Substance dependence
   05030 Cocaine addiction
    9586 (CREB5)
   05031 Amphetamine addiction
    9586 (CREB5)
   05034 Alcoholism
    9586 (CREB5)
  Infectious diseases
   05161 Hepatitis B
    9586 (CREB5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    9586 (CREB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15.1
AA seq 369 aa AA seqDB search
MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPME
RQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMM
EMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSH
LHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRR
KFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHK
DCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTT
HRTDLNPIL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcacctcaggagggaattcagcctcagtgatgtccatgaggcctgtcccaggc
tctctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatg
cctgggaccctgcccaaccctacaatgccaggatcttccgccgtcttgatgccaatggag
cgacaaatgtcagtgaactccagcatcatggggatgcaaggtccaaatctcagcaacccc
tgtgcttctccccaggtccagccaatgcattcagaagccaaaatgaggttgaaggctgca
ttgactcaccaccctgctgccatgtcaaatgggaacatgaacaccatgggacacatgatg
gagatgatgggctcccggcaggaccagacgccacaccatcacatgcactcgcacccgcat
cagcaccagacactgccaccccatcacccttacccacaccagcaccagcacccagcacac
catcctcaccctcaaccccatcaccagcagaaccatccacatcaccactcccattcccac
cttcatgcacacccagcacatcaccagacctcgccacatccgcccctgcacaccggcaac
caagcacaggtttcaccagcaacacaacagatgcagccaacccagacaatacagccaccc
cagcccacaggggggcgccggcgaagggtggtagacgaggatccggacgagaggcggcgg
aaatttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgg
gtgatgtcattggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaat
gaagtgtctatgttgaaaaatgaggtggcccagctgaaacagttgttgttaacacataaa
gactgcccaataacagccatgcagaaagaatcacaaggatatctaagtccagagagtagc
cctcctgctagtcctgtcccagcttgctcccagcaacaagtcatccagcataataccatc
actacttcctcatcggtcagcgaggtggtaggaagctccaccctcagccagctcaccact
cacagaacagacctgaatccgattctttaa

DBGET integrated database retrieval system