KEGG   Homo sapiens (human): 9587Help
Entry
9587              CDS       T01001                                 

Gene name
MAD2L1BP, CMT2
Definition
(RefSeq) MAD2L1 binding protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 274 aa AA seqDB search
MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVF
PGPVSQEGCCQFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVS
SRKCQQALAELESVLSHLEDFFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQS
LSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHK
LTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccggaggcggaggttctgtcctcagccgcagtccctgatttggagtggtat
gagaagtccgaagaaactcacgcctcccagatagaactacttgagacaagctctacgcag
gaacctctcaacgcttcggaggccttttgcccaagagactgcatggtaccagtggtgttt
cctgggcctgtgagccaggaaggctgctgtcagtttacttgtgaacttctaaagcatatc
atgtatcaacgccagcagctccctctgccctatgaacagcttaagcacttttaccgaaaa
ccttctccccaggcagaggagatgctgaagaagaaacctcgggccaccactgaggtgagc
agcaggaaatgccaacaagccctggcagaactggagagtgtcctcagccacctggaggac
ttctttgcacggacactagtaccgcgagtgctgattctccttgggggcaatgccctaagc
cccaaggagttctatgaactcgacttgtctctgctggccccctacagcgtggaccagagc
ctgagcacagcagcttgtttgcgccgtctcttccgagccatattcatggctgatgccttt
agcgagcttcaggctcctccactcatgggcaccgtcgtcatggcacagggacaccgcaac
tgtggagaagattggtttcgacccaagctcaactatcgagtgcccagccggggccataaa
ctgactgtgaccctgtcatgtggcagaccttccatccgaaccacggcttgggaagactac
atttggttccaggcaccagtgacatttaaaggcttccgcgagtga

DBGET integrated database retrieval system