KEGG   Homo sapiens (human): 9590Help
Entry
9590              CDS       T01001                                 

Gene name
AKAP12, AKAP250, SSeCKS
Definition
A kinase (PRKA) anchor protein 12
Orthology
K16528  
A-kinase anchor protein 12
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
6q24-q25
AA seq 1782 aa AA seqDB search
MGAGSSTEQRSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPATKLLQKNG
QLSTINGVAEQDELSLQEGDLNGQKGALNGQGALNSQEEEEVIVTEVGQRDSEDVSKRDS
DKEMATKSAVVHDITDDGQEETPEIIEQIPSSESNLEELTQPTESQANDIGFKKVFKFVG
FKFTVKKDKTEKPDTVQLLTVKKDEGEGAAGAGDHKDPSLGAGEAASKESEPKQSTEKPE
ETLKREQSHAEISPPAESGQAVEECKEEGEEKQEKEPSKSAESPTSPVTSETGSTFKKFF
TQGWAGWRKKTSFRKPKEDEVEASEKKKEQEPEKVDTEEDGKAEVASEKLTASEQAHPQE
PAESAHEPRLSAEYEKVELPSEEQVSGSQGPSEEKPAPLATEVFDEKIEVHQEEVVAEVH
VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGA
DLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGG
DEESGEHTQVPADSPDSQEEQKGESSASSPEEPEEITCLEKGLAEVQQDGEAEEGATSDG
EKKREGVTPWASFKKMVTPKKRVRRPSESDKEDELDKVKSATLSSTESTASEMQEEMKGS
VEEPKPEEPKRKVDTSVSWEALICVGSSKKRARRGSSSDEEGGPKAMGGDHQKADEAGKD
KETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFKRLVTPRKKSKSKLEEKS
EDSIAGSGVEHSTPDTEPGKEESWVSIKKFIPGRRKKRPDGKQEQAPVEDAGPTGANEDD
SDVPAVVPLSEYDAVEREKMEAQQAQKSAEQPEQKAATEVSKELSESQVHMMAAAVADGT
RAATIIEERSPSWISASVTEPLEQVEAEAALLTEEVLEREVIAEEEPPTVTEPLPENREA
RGDTVVSEAELTPEAVTAAETAGPLGAEEGTEASAAEETTEMVSAVSQLTDSPDTTEEAT
PVQEVEGGVPDIEEQERRTQEVLQAVAEKVKEESQLPGTGGPEDVLQPVQRAEAERPEEQ
AEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQ
AETLAGVKSQEMVMEQAIPPDSVETPTDSETDGSTPVADFDAPGTTQKDEIVEIHEENEV
ASGTQSGGTEAEAVPAQKERPPAPSSFVFQEETKEQSKMEDTLEHTDKEVSVETVSILSK
TEGTQEADQYADEKTKDVPFFEGLEGSIDTGITVSREKVTEVALKGEGTEEAECKKDDAL
ELQSHAKSPPSPVEREMVVQVEREKTEAEPTHVNEEKLEHETAVTVSEEVSKQLLQTVNV
PIIDGAKEVSSLEGSPPPCLGQEEAVCTKIQVQSSEASFTLTAAAEEEKVLGETANILET
GETLEPAGAHLVLEEKSSEKNEDFAAHPGEDAVPTGPDCQAKSTPVIVSATTKKGLSSDL
EGEKTTSLKWKSDEVDEQVACQEVKVSVAIEDLEPENGILELETKSSKLVQNIIQTAVDQ
FVRTEETATEMLTSELQTQAHVIKADSQDAGQETEKEGEEPQASAQDETPITSAKEESES
TAVGQAHSDISKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDG
HALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDTNGPKQKEKED
AQEVELQEGKVHSESDKAITPQAQEELQKQERESAKSELTES
NT seq 5349 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggagctccaccgagcagcgcagcccggagcagccgcccgaggggagctcc
acgccggctgagcccgagcccagcggcggcggcccctcggccgaggcggcgccagacacc
accgcggaccccgccatcgctgcctcggaccccgccaccaagctcctacagaagaatggt
cagctgtccaccatcaatggcgtagctgagcaagatgagctcagcctccaggagggtgac
ctaaatggccagaaaggagccctgaacggtcaaggagccctaaacagccaggaggaagaa
gaagtcattgtcacagaggttggacagagagactctgaagatgtgagcaaaagagactcc
gataaagagatggctactaagtcagcggttgttcacgacatcacagatgatgggcaggag
gagacacccgaaataatcgaacagattccttcttcagaaagcaatttagaagagctaaca
caacccactgagtcccaggctaatgatattggatttaagaaggtgtttaagtttgttggc
tttaaattcactgtgaaaaaggataagacagagaagcctgacactgtccagctactcact
gtgaagaaagatgaaggggagggagcagcaggggctggcgaccacaaggaccccagcctt
ggggctggagaagcagcatccaaagaaagcgaacccaaacaatctacagagaaacccgaa
gagaccctgaagcgtgagcaaagccacgcagaaatttctcccccagccgaatctggccaa
gcagtggaggaatgcaaagaggaaggagaagagaaacaagaaaaagaacctagcaagtct
gcagaatctccgactagtcccgtgaccagtgaaacaggatcaaccttcaaaaaattcttc
actcaaggttgggccggctggcgcaaaaagaccagtttcaggaagccgaaggaggatgaa
gtggaagcttcagagaagaaaaaggaacaagagccagaaaaagtagacacagaagaagac
ggaaaggcagaggttgcctccgagaaactgaccgcctccgagcaagcccacccacaggag
ccggcagaaagtgcccacgagccccggttatcagctgaatatgagaaagttgagctgccc
tcagaggagcaagtcagtggctcgcagggaccttctgaagagaaacctgctccgttggcg
acagaagtgtttgatgagaaaatagaagtccaccaagaagaggttgtggccgaagtccac
gtcagcaccgtggaggagagaaccgaagagcagaaaacggaggtggaagaaacagcaggg
tctgtgccagctgaagaattggttgaaatggatgcagaacctcaggaagctgaacctgcc
aaggagctggtgaagctcaaagaaacgtgtgtttccggagaggaccctacacagggagct
gacctcagtcctgatgagaaggtgctgtccaaaccccccgaaggcgttgtgagtgaggtg
gaaatgctgtcatcacaggagagaatgaaggtgcagggaagtccactaaagaagcttttt
accagcactggcttaaaaaagctttctggaaagaaacagaaagggaaaagaggaggagga
gacgaggaatcaggggagcacactcaggttccagccgattctccggacagccaggaggag
caaaagggcgagagctctgcctcatcccctgaggagcccgaggagatcacgtgtctggaa
aagggcttagccgaggtgcagcaggatggggaagctgaagaaggagctacttccgatgga
gagaaaaaaagagaaggtgtcactccctgggcatcattcaaaaagatggtgacgcccaag
aagcgtgttagacggccttcggaaagtgataaagaagatgagctggacaaggtcaagagc
gctaccttgtcttccaccgagagcacagcctctgaaatgcaagaagaaatgaaagggagc
gtggaagagccaaagccggaagaaccaaagcgcaaggtggatacctcagtatcttgggaa
gctttaatttgtgtgggatcatccaagaaaagagcaaggagagggtcctcttctgatgag
gaagggggaccaaaagcaatgggaggagaccaccagaaagctgatgaggccggaaaagac
aaagagacggggacagacgggatccttgctggttcccaagaacatgatccagggcaggga
agttcctccccggagcaagctggaagccctaccgaaggggagggcgtttccacctgggag
tcatttaaaaggttagtcacgccaagaaaaaaatcaaagtccaagctggaagagaaaagc
gaagactccatagctgggtctggtgtagaacattccactccagacactgaacccggtaaa
gaagaatcctgggtctcaatcaagaagtttattcctggacgaaggaagaaaaggccagat
gggaaacaagaacaagcccctgttgaagacgcagggccaacaggggccaacgaagatgac
tctgatgtcccggccgtggtccctctgtctgagtatgatgctgtagaaagggagaaaatg
gaggcacagcaagcccaaaaaagcgcagagcagcccgagcagaaggcagccactgaggtg
tccaaggagctcagcgagagtcaggttcatatgatggcagcagctgtcgctgacgggacg
agggcagctaccattattgaagaaaggtctccttcttggatatctgcttcagtgacagaa
cctcttgaacaagtagaagctgaagccgcactgttaactgaggaggtattggaaagagaa
gtaattgcagaagaagaaccccccacggttactgaacctctgccagagaacagagaggcc
cggggcgacacggtcgttagtgaggcggaattgacccccgaagctgtgacagctgcagaa
actgcagggccattgggtgccgaagaaggaaccgaagcatctgctgctgaagagaccaca
gaaatggtgtcagcagtctcccagttaaccgactccccagacaccacagaggaggccact
ccggtgcaggaggtggaaggtggcgtacctgacatagaagagcaagagaggcggactcaa
gaggtcctccaggcagtggcagaaaaagtgaaagaggaatcccagctgcctggcaccggt
gggccagaagatgtgcttcagcctgtgcagagagcagaggcagaaagaccagaagagcag
gctgaagcgtcgggtctgaagaaagagacggatgtagtgttgaaagtagatgctcaggag
gcaaaaactgagccttttacacaagggaaggtggtggggcagaccaccccagaaagcttt
gaaaaagctcctcaagtcacagagagcatagagtccagtgagcttgtaaccacttgtcaa
gccgaaaccttagctggggtaaaatcacaggagatggtgatggaacaggctatcccccct
gactcggtggaaacccctacagacagtgagactgatggaagcacccccgtagccgacttt
gacgcaccaggcacaacccagaaagacgagattgtggaaatccatgaggagaatgaggtc
gcatctggtacccagtcagggggcacagaagcagaggcagttcctgcacagaaagagagg
cctccagcaccttccagttttgtgttccaggaagaaactaaagaacaatcaaagatggaa
gacactctagagcatacagataaagaggtgtcagtggaaactgtatccattctgtcaaag
actgaggggactcaagaggctgaccagtatgctgatgagaaaaccaaagacgtaccattt
ttcgaaggacttgaggggtctatagacacaggcataacagtcagtcgggaaaaggtcact
gaagttgcccttaaaggtgaagggacagaagaagctgaatgtaaaaaggatgatgctctt
gaactgcagagtcacgctaagtctcctccatcccccgtggagagagagatggtagttcaa
gtcgaaagggagaaaacagaagcagagccaacccatgtgaatgaagagaagcttgagcac
gaaacagctgttaccgtatctgaagaggtcagtaagcagctcctccagacagtgaatgtg
cccatcatagatggggcaaaggaagtcagcagtttggaaggaagccctcctccctgccta
ggtcaagaggaggcagtatgcaccaaaattcaagttcagagctctgaggcatcattcact
ctaacagcggctgcagaggaggaaaaggtcttaggagaaactgccaacattttagaaaca
ggtgaaacgttggagcctgcaggtgcacatttagttctggaagagaaatcctctgaaaaa
aatgaagactttgccgctcatccaggggaagatgctgtgcccacagggcccgactgtcag
gcaaaatcgacaccagtgatagtatctgctactaccaagaaaggcttaagttccgacctg
gaaggagagaaaaccacatcactgaagtggaagtcagatgaagtcgatgagcaggttgct
tgccaggaggtcaaagtgagtgtagcaattgaggatttagagcctgaaaatgggattttg
gaacttgagaccaaaagcagtaaacttgtccaaaacatcatccagacagccgttgaccag
tttgtacgtacagaagaaacagccaccgaaatgttgacgtctgagttacagacacaagct
cacgtgataaaagctgacagccaggacgctggacaggaaacggagaaagaaggagaggaa
cctcaggcctctgcacaggatgaaacaccaattacttcagccaaagaggagtcagagtca
accgcagtgggacaagcacattctgatatttccaaagacatgagtgaagcctcagaaaag
accatgactgttgaggtagaaggttccactgtaaatgatcagcagctggaagaggtcgtc
ctcccatctgaggaagagggaggtggagctggaacaaagtctgtgccagaagatgatggt
catgccttgttagcagaaagaatagagaagtcactagttgaaccgaaagaagatgaaaaa
ggtgatgatgttgatgaccctgaaaaccagaactcagccctggctgatactgatgcctca
ggaggcttaaccaaagagtccccagatacaaatggaccaaaacaaaaagagaaggaggat
gcccaggaagtagaattgcaggaaggaaaagtgcacagtgaatcagataaagcgatcaca
ccccaagcacaggaggagttacagaaacaagagagagaatctgcaaagtcagaacttaca
gaatcttaa

DBGET integrated database retrieval system