KEGG   Homo sapiens (human): 9611Help
Entry
9611              CDS       T01001                                 

Gene name
NCOR1, N-CoR, N-CoR1, PPP1R109, TRAC1, hN-CoR
Definition
(RefSeq) nuclear receptor corepressor 1
  KO
K04650  
nuclear receptor co-repressor 1
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    9611 (NCOR1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    9611 (NCOR1)
  Drug resistance
   01522 Endocrine resistance
    9611 (NCOR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9611 (NCOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75376(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17p12-p11.2
AA seq 2440 aa AA seqDB search
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQ
RVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR
KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ
RVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM
NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL
TKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDE
KEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAA
AAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEA
QCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEE
ENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESV
ETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDN
TKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFP
MDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALY
QRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPE
GVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPK
PSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQ
EGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKG
REEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSM
RESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKR
ESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEG
SISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKA
GETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMN
RTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVY
RSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITS
QQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITY
IPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRP
GSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPA
GGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAV
SEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELR
TRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPAS
SPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMG
QVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNR
YSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHE
KQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSG
GGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVE
DHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIP
GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTP
IACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD
NT seq 7323 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagttcaggttatcctcccaaccaaggagcattcagcacagaacaaagtcgttat
cctcctcactctgtccagtatacatttcccaacacccgccaccagcaggagttcgcagtc
cctgattatcgttcctctcatcttgaagtgagtcaggcatcacagcttttgcagcaacag
cagcagcaacagcttcgaaggcgaccttccttgctttcagaatttcacccaggttctgac
aggcctcaagaaaggagaactagttatgaaccgtttcatccaggcccatccccagtggat
catgattcactggaatcgaagcgaccacgtctggaacaggtttctgattctcattttcag
cgtgtcagtgctgcggttttgcctttagtgcacccgctgccagaagggctgagggcttct
gcagatgctaagaaggatccagcattcggaggcaaacatgaagctccatcctctccaatt
tcggggcaaccatgtggagatgatcaaaatgcttcaccttcaaaactctcaaaggaagag
ttaatacagagtatggatcgtgtagatcgagaaattgcaaaagtagaacagcagatcctt
aaactgaaaaagaaacaacaacagcttgaagaagaggcagctaaacctcctgagcctgag
aagcccgtgtcccctcctcctgtggagcagaaacaccgcagtattgtccaaattatttat
gatgagaatcggaaaaaagcagaagaagctcataaaatttttgaaggtcttggcccaaaa
gttgaactgccactgtataaccagccatcagataccaaggtgtaccatgagaacatcaag
acaaaccaggtgatgaggaaaaaactcattttattttttaaaagaagaaatcatgcaaga
aaacaaagggaacaaaaaatctgccagcgttatgatcagctcatggaggcatgggagaaa
aaagtggacagaatagaaaataatcctcggaggaaagctaaagaaagcaaaacaagggaa
tactatgaaaagcagtttccagaaattcgaaaacaaagagaacagcaagaaagatttcag
cgagttgggcagaggggagctggtctttcagccaccattgctaggagtgagcatgagatt
tctgaaattattgatgggctctctgagcaggagaataatgagaaacaaatgcggcagctc
tctgtgattccacctatgatgtttgatgcagaacaaagacgagtcaagttcattaacatg
aatgggcttatggaggaccctatgaaagtgtataaagataggcagtttatgaatgtttgg
actgaccatgaaaaggagatctttaaggacaagtttatccagcatccaaaaaactttgga
ctaattgcatcatacttggagaggaagagtgttcctgattgtgttttgtattactattta
accaagaaaaatgagaattataaagccctcgtcagaaggaattatgggaaacgcagaggc
agaaaccagcaaattgctcgaccctcgcaagaagaaaaagtagaagaaaaagaagaggat
aaagcagaaaaaacagaaaaaaaagaagaagaaaagaaagatgaagaggaaaaagatgaa
aaagaagactccaaagaaaataccaaggaaaaggacaagatagatggtacagcagaagaa
actgaggaaagagagcaagccacaccccgggggcgaaagactgccaacagtcagggccgc
cgtaagggccggatcaccaggtccatgacaaacgaagctgcagctgccagtgctgcagcc
gcagcggctactgaagagcccccaccacctctgccaccgccaccagaacccatttctaca
gagcctgtggagacctctcgatggacagaagaagaaatggaagttgctaaaaaaggtcta
gtagaacatggtcgtaactgggcagcaattgctaaaatggtgggaacgaaaagtgaagct
caatgtaaaaacttctattttaactataaaaggcgacacaatcttgacaacctcttacag
cagcataaacagaaaacttcacgaaaacctcgtgaagagcgagatgtgtctcaatgtgaa
agtgtcgcttccactgtttctgctcaggaggatgaagatattgaagcctccaatgaagaa
gaaaatccagaagacagcgaagttgaagctgtcaagcccagcgaggacagtcctgaaaat
gctacttctcgaggaaacacagaacctgcggttgagcttgagcccaccacggaaactgca
cccagtacatctccctccttagcagttccaagtacaaaaccagctgaagatgaaagtgtg
gagacccaggtgaatgacagcatcagtgctgagacagcagagcagatggatgtagatcag
caggagcacagtgctgaagagggttctgtttgtgatcccccacccgctaccaaagctgac
tctgtggacgttgaagtgagggtgccagaaaaccatgcatctaaagttgaaggtgataat
accaaagaaagagacttggatagagccagtgagaaggtggaacctagagatgaagatttg
gtggtagctcagcaaataaatgcccaaaggcccgagccccagtcagacaatgattccagt
gccacgtgcagcgctgatgaggatgtggatggagagccagagaggcagagaatgtttcct
atggactcaaagccttcactgttaaaccccactggatctatactcgtctcatctccgtta
aaaccaaatccactggatctgccacagcttcagcatcgagctgctgttatcccaccaatg
gtatcctgcaccccatgtaacataccaattggaaccccagtgagcggctatgctctctac
cagcgacacattaaagcaatgcatgagtcagcactcctggaggagcagcggcagagacaa
gaacagatagatttggaatgtagaagttctacaagtccatgtggcacatccaagagtcca
aacagagagtgggaagtccttcagcctgctccacatcaagtgataactaatctccctgaa
ggcgttcggcttccgacaactcgaccaaccaggccaccgccccctctcatcccgtcatcc
aaaaccacagtggcttcagaaaaaccatcttttataatgggaggctccatctcacaggga
acaccaggcacttatttgacttctcataatcaggcttcctacactcaagaaacacccaag
ccgtcagtgggatctatctctcttggactgccacggcaacaggaatctgccaaatcagct
actttgccctacatcaagcaggaagaattttctccccgaagccaaaactcacaacctgag
ggtctgttggtcagggcccaacatgaaggtgtagtcagaggtaccgcaggagccatacaa
gaaggaagtataactcggggaactccaaccagcaaaatttcagtggagagcattccatcc
ctacggggctctatcactcagggcaccccggctctgccccagactggcataccaacagag
gctttggtgaaggggtccatttcgagaatgcccattgaagacagcagtcctgagaaaggc
agagaggaagctgcatccaaaggccatgttatttatgaaggcaaaagtggacatatcttg
tcatatgataatattaagaatgcccgagaagggactaggagtccaagaacagctcatgaa
atcagtttaaagagaagctatgaatcagtggaaggaaatataaagcaagggatgtcaatg
agggagtctcctgtatcagcaccgttagaggggctgatatgccgagcattacccaggggg
agtcctcattctgacctcaaagaaaggactgtattgtctggctccataatgcaggggaca
ccaagagcaacaactgaaagctttgaagatggccttaaatatcccaaacaaattaaaagg
gaaagtcctcccatacgagcatttgaaggtgccattaccaaaggaaaaccatatgatggc
atcaccaccatcaaagaaatggggcgttccattcatgagattccaaggcaagatatttta
actcaggaaagtcggaaaactccagaagtggtccagagcacacggccgataattgagggt
tccatttcccagggcacaccaataaagtttgacaacaactcaggtcaatctgccatcaaa
cacaatgtcaaatccttaatcacggggcctagcaaactatcccgtggaatgcctccgctg
gaaattgtgccagagaacataaaagtggtagaacggggaaaatatgaggatgtgaaagca
ggcgagaccgtgcgttcccggcacacgtcagtggtaagctctggcccctccgttcttagg
tccacactgcatgaagctcccaaagcacaactgagccctgggatttatgatgacaccagt
gcacggaggacccctgtgagttatcaaaacaccatgtccagaggctcacccatgatgaac
agaacttctgatgttacaatttcttctaacaagtctaccaatcatgaaaggaaatcgaca
ctgacccctacccagagggaaagtatcccagcgaagtctccagtgcctggggtggaccct
gtcgtgagccacagtccgtttgatccccatcacagaggcagcactgcaggcgaggtttat
cggagccacctgcccacgcacttggatccagccatgccttttcacagggctttggatcct
gcagcggctgcttacctgtttcagagacagctttcaccaactccaggttacccaagtcag
tatcagctttacgcaatggagaacacaagacagacaatcttaaatgattacattacctca
caacagatgcaagtgaacttgcgtccagatgtggccagaggactctccccaagagagcag
ccactgggtctcccatacccagcaacgagaggaatcattgacctgaccaatatgcctcca
acaattttagtgcctcatccagggggaacaagcactcctcccatggacagaatcacttat
attcctggtacacagattactttccctcccaggccgtacaactctgcttccatgtctcca
ggacacccaacacaccttgcagctgctgcaagtgctgagagggaacgggaacgggagcgg
gagaaggagcgggagcgggaacggattgctgcagcttcctccgacctctacctgcggcca
ggctcagaacagcctggccgacctggcagtcatggatatgttcgctccccttccccttca
gtaagaactcaggagaccatgttgcaacagagacccagtgttttccaaggaaccaatgga
accagtgtaatcacacctttggatccaactgctcagctacgaatcatgccactgcctgct
gggggcccttcaataagccaaggcctgccagcctcccgttacaacactgctgcggatgcc
ctggctgctcttgtggatgctgcagcttctgcaccccagatggatgtgtccaaaacaaaa
gagagtaagcatgaagctgccaggttagaagaaaatttgagaagcaggtcagcagcagtt
agtgaacagcagcagctagagcagaaaaccctggaggtggagaagagatctgttcagtgt
ttatacacttcttcagcctttccaagtggcaagccccagcctcattcttcagtagtttat
tctgaggctgggaaagataaagggcctcctccaaaatccagatatgaggaagagctaagg
accagagggaagactaccattactgcagctaacttcatagacgtgatcatcacccggcaa
attgcctcggacaaggatgcgagggaacgtggctctcaaagttcagactcttctagtagc
ttatcttctcacaggtatgaaacacctagcgatgctattgaggtgataagtcctgccagc
tcacctgcgccaccccaggagaaactgcagacctatcagccagaggttgttaaggcaaat
caagcggaaaatgatcctaccagacaatatgaaggaccattacatcactatcgaccacag
caggaatcaccatctccccaacaacagctgcccccttcttcacaggcagagggaatgggg
caagtgcccaggacccatcggctgatcacacttgctgatcacatctgtcaaattatcaca
caagattttgctagaaatcaagtttcctcgcagactccccagcagcctcctacttctaca
ttccagaactcaccttctgctttggtatctacacctgtgaggactaaaacatcaaaccgt
tacagcccagaatcccaggctcagtctgtccatcatcaaagaccaggttcaagggtctct
ccagaaaatcttgtggacaaatccaggggaagtaggcctggaaaatccccagagaggagt
cacgtctcttcggagccctacgagcccatctccccaccccaggttccggttgtgcatgag
aaacaggacagcttgctgctcttgtctcagaggggcgcagagcctgcagagcagaggaat
gatgcccgctcaccagggagtataagctacttgccttcattcttcaccaagcttgaaaat
acatcacccatggttaaatcaaagaagcaggagatttttcgtaagttgaactcctctggt
ggaggtgactctgatatggcagctgctcagccaggaactgagatctttaatctgccagca
gttactacgtcaggctcagttagctctagaggccattcttttgctgatcctgccagtaat
cttgggctggaagacattatcaggaaggctctcatgggaagctttgatgacaaagttgag
gatcatggagttgtcatgtcccagcctatgggagtagtgcctggtactgccaacacctca
gttgtgaccagtggtgagacacgaagagaggaaggggacccatcacctcattcaggagga
gtttgcaaaccaaagctgatcagcaagtcaaacagcaggaaatctaagtctcctatacct
gggcaaggctacttaggaacggaacggccctcttcagtctcctctgtacattcagaaggg
gattaccataggcagacgccagggtgggcctgggaagacaggccctcttcaacaggctca
actcagtttccttataaccctctgactatgcggatgctcagcagtactccaccaacaccg
attgcatgtgctccctctgcggtgaaccaagcagctcctcaccaacagaacaggatctgg
gagcgagagcctgccccactgctctcagcacagtacgagaccctgtcggatagtgatgac
tga

DBGET integrated database retrieval system