KEGG   Homo sapiens (human): 9612Help
Entry
9612              CDS       T01001                                 

Gene name
NCOR2, CTG26, N-CoR2, SMAP270, SMRT, SMRTE, SMRTE-tau, TNRC14, TRAC, TRAC-1, TRAC1
Definition
(RefSeq) nuclear receptor corepressor 2
  KO
K06065  
nuclear receptor co-repressor 2
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    9612 (NCOR2)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    9612 (NCOR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24
AA seq 2514 aa AA seqDB search
MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQ
PQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRP
SPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEA
AHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQ
RYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPM
KVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
SLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN
DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQ
SAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQ
NLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEE
AEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPP
GPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEG
EEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGS
GRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKP
LDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR
GKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPP
GHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEH
AKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTAL
GSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGRE
DSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGR
AISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKR
EGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELP
LAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALE
RACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPV
TTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSG
VDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALE
NRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHL
PVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDR
DRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPI
SPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGG
TLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRP
LVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGY
HGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHL
PHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPL
YSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIE
PVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMV
KSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLE
AIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKA
KVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFP
YNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE
NT seq 7545 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggatccacacagcctgtggcacagacgtggagggccactgagccccgctacccg
ccccacagcctttcctacccagtgcagatcgcccggacgcacacggacgtcgggctcctg
gagtaccagcaccactcccgcgactatgcctcccacctgtcgcccggctccatcatccag
ccccagcggcggaggccctccctgctgtctgagttccagcccgggaatgaacggtcccag
gagctccacctgcggccagagtcccactcatacctgcccgagctggggaagtcagagatg
gagttcattgaaagcaagcgccctcggctagagctgctgcctgaccccctgctgcgaccg
tcacccctgctggccacgggccagcctgcgggatctgaagacctcaccaaggaccgtagc
ctgacgggcaagctggaaccggtgtctccccccagccccccgcacactgaccctgagctg
gagctggtgccgccacggctgtccaaggaggagctgatccagaacatggaccgcgtggac
cgagagatcaccatggtagagcagcagatctctaagctgaagaagaagcagcaacagctg
gaggaggaggctgccaagccgcccgagcctgagaagcccgtgtcaccgccgcccatcgag
tcgaagcaccgcagcctggtgcagatcatctacgacgagaaccggaagaaggctgaagct
gcacatcggattctggaaggcctggggccccaggtggagctgccgctgtacaaccagccc
tccgacacccggcagtatcatgagaacatcaaaataaaccaggcgatgcggaagaagcta
atcttgtacttcaagaggaggaatcacgctcggaaacaatgggagcagaagttctgccag
cgctatgaccagctcatggaggcctgggagaagaaggtggagcgcatcgagaacaacccc
cggcggcgggccaaggagagcaaggtgcgcgagtactacgagaagcagttccctgagatc
cgcaagcagcgcgagctgcaggagcgcatgcagagcagggtgggccagcggggcagtggg
ctgtccatgtcggccgcccgcagcgagcacgaggtgtcagagatcatcgatggcctctca
gagcaggagaacctggagaagcagatgcgccagctggccgtgatcccgcccatgctgtac
gacgctgaccagcagcgcatcaagttcatcaacatgaacgggcttatggccgaccccatg
aaggtgtacaaagaccgccaggtcatgaacatgtggagtgagcaggagaaggagaccttc
cgggagaagttcatgcagcatcccaagaactttggcctgatcgcatcattcctggagagg
aagacagtggctgagtgcgtcctctattactacctgactaagaagaatgagaactataag
agcctggtgagacggagctatcggcgccgcggcaagagccagcagcagcaacaacagcag
cagcagcagcagcagcagcagcagcagcagcccatgccccgcagcagccaggaggagaaa
gatgagaaggagaaggaaaaggaggcggagaaggaggaggagaagccggaggtggagaac
gacaaggaagacctcctcaaggagaagacagacgacacctcaggggaggacaacgacgag
aaggaggctgtggcctccaaaggccgcaaaactgccaacagccagggaagacgcaaaggc
cgcatcacccgctcaatggctaatgaggccaacagcgaggaggccatcaccccccagcag
agcgccgagctggcctccatggagctgaatgagagttctcgctggacagaagaagaaatg
gaaacagccaagaaaggtctcctggaacacggccgcaactggtcggccatcgcccggatg
gtgggctccaagactgtgtcgcagtgtaagaacttctacttcaactacaagaagaggcag
aacctcgatgagatcttgcagcagcacaagctgaagatggagaaggagaggaacgcgcgg
aggaagaagaagaaagcgccggcggcggccagcgaggaggctgcattcccgcccgtggtg
gaggatgaggagatggaggcgtcgggcgtgagcggaaatgaggaggagatggtggaggag
gctgaagccttacatgcctctgggaatgaggtgcccagaggggaatgcagtggcccagcc
actgtcaacaacagctcagacaccgagagcatcccctctcctcacactgaggccgccaag
gacacagggcagaatgggcccaagcccccagccaccctgggcgccgacgggccaccccca
gggccacccaccccaccaccggaggacatcccggcccccactgagcccaccccggcctct
gaagccaccggagcccctacgcccccaccagcacccccatcgccctctgcacctcctcct
gtggtccccaaggaggagaaggaggaggagaccgcagcagcgcccccagtggaggagggg
gaggagcagaagccccccgcggctgaggagctggcagtggacacagggaaggccgaggag
cccgtcaagagcgagtgcacggaggaagccgaggaggggccggccaagggcaaggacgcg
gaggccgctgaggccacggccgagggggcgctcaaggcagagaagaaggagggcgggagc
ggcagggccaccacagccaagagctcgggcgccccccaggacagcgactccagtgctacc
tgcagtgcagacgaggtggatgaggccgagggcggcgacaagaaccggctgctgtcccca
aggcccagcctcctcaccccgactggcgacccccgggccaatgcctcaccccagaagcca
ctggacctgaagcagctgaagcagcgagcggctgccatcccccccatccaggtcaccaaa
gtccatgagcccccccgggaggacgcagctcccaccaagccagctcccccagccccaccg
ccaccgcaaaacctgcagccggagagcgacgcccctcagcagcctggcagcagcccccgg
ggcaagagcaggagcccggcaccccccgccgacaaggaggccttcgcagccgaggcccag
aagctgcctggggaccccccttgctggacttccggcctgcccttccccgtgcccccccgt
gaggtgatcaaggcctccccgcatgccccggacccctcagccttctcctacgctccacct
ggtcacccactgcccctgggcctccatgacactgcccggcccgtcctgccgcgcccaccc
accatctccaacccgcctcccctcatctcctctgccaagcaccccagcgtcctcgagagg
caaataggtgccatctcccaaggaatgtcggtccagctccacgtcccgtactcagagcat
gccaaggccccggtgggccctgtcaccatggggctgcccctgcccatggaccccaaaaag
ctggcacccttcagcggagtgaagcaggagcagctgtccccacggggccaggctgggcca
ccggagagcctgggggtgcccacagcccaggaggcgtccgtgctgagagggacagctctg
ggctcagttccgggcggaagcatcaccaaaggcattcccagcacacgggtgccctcggac
agcgccatcacataccgcggctccatcacccacggcacgccagctgacgtcctgtacaag
ggcaccatcaccaggatcatcggcgaggacagcccgagtcgcttggaccgcggccgggag
gacagcctgcccaagggccacgtcatctacgaaggcaagaagggccacgtcttgtcctat
gagggtggcatgtctgtgacccagtgctccaaggaggacggcagaagcagctcaggaccc
ccccatgagacggccgcccccaagcgcacctatgacatgatggagggccgcgtgggcaga
gccatctcctcagccagcatcgaaggtctcatgggccgtgccatcccgccggagcgacac
agcccccaccacctcaaagagcagcaccacatccgcgggtccatcacacaagggatccct
cggtcctacgtggaggcacaggaggactacctgcgtcgggaggccaagctcctaaagcgg
gagggcacgcctccgcccccaccgccctcacgggacctgaccgaggcctacaagacgcag
gccctgggccccctgaagctgaagccggcccatgagggcctggtggccacggtgaaggag
gcgggccgctccatccatgagatcccgcgcgaggagctgcggcacacgcccgagctgccc
ctggccccgcggccgctcaaggagggctccatcacgcagggcaccccgctcaagtacgac
accggcgcgtccaccactggctccaaaaagcacgacgtacgctccctcatcggcagcccc
ggccggacgttcccacccgtgcacccgctggatgtgatggccgacgcccgggcactggaa
cgtgcctgctacgaggagagcctgaagagccggccagggaccgccagcagctcggggggc
tccattgcgcgcggcgccccggtcattgtgcctgagctgggtaagccgcggcagagcccc
ctgacctatgaggaccacggggcaccctttgccggccacctcccacgaggttcgcccgtg
accacgcgggagcccacgccgcgcctgcaggagggcagcctttcgtccagcaaggcatcc
caggaccgaaagctgacgtcgacgcctcgtgagatcgccaagtccccgcacagcaccgtg
cccgagcaccacccacaccccatctcgccctatgagcacctgcttcggggcgtgagtggc
gtggacctgtatcgcagccacatccccctggccttcgaccccacctccataccccgcggc
atccctctggacgcagccgctgcctactacctgccccgacacctggcccccaaccccacc
tacccgcacctgtacccaccctacctcatccgcggctaccccgacacggcggcgctggag
aaccggcagaccatcatcaatgactacatcacctcgcagcagatgcaccacaacgcggcc
accgccatggcccagcgagctgatatgctgaggggcctctcgccccgcgagtcctcgctg
gcactcaactacgctgcgggtccccgaggcatcatcgacctgtcccaagtgccacacctg
cctgtgctcgtgcccccgacaccaggcaccccagccaccgccatggaccgccttgcctac
ctccccaccgcgccccagcccttcagcagccgccacagcagctccccactctccccagga
ggtccaacacacttgacaaaaccaaccaccacgtcctcgtccgagcgggagcgagaccgg
gatcgagagcgggaccgggatcgggagcgggaaaagtccatcctcacgtccaccacgacg
gtggagcacgcacccatctggagacctggtacagagcagagcagcggcagcagcggcggg
ggtgggggcagcagcagccgccccgcctcccactcccatgcccaccagcactcgcccatc
tcccctcggacccaggatgccctccagcagagacccagtgtgcttcacaacacaggcatg
aagggtatcatcaccgctgtggagcccagcacgcccacggtcctgaggtccacctccacc
tcctcacccgttcgcccggctgccacattcccacctgccacccactgcccactgggcggc
accctcgatggggtctaccctaccctcatggagcccgtcttgctgcccaaggaggccccc
cgggtcgcccggccagagcggccccgagcagacaccggccatgccttcctcgccaagccc
ccagcccgctccgggctggagcccgcctcctcccccagcaagggctcggagccccggccc
ctagtgcctcctgtctctggccacgccaccatcgcccgcacccctgcgaagaacctcgca
cctcaccacgccagcccggacccgccggcgccacctgcctcggcctcggacccgcaccgg
gaaaagactcaaagtaaacccttttccatccaggaactggaactccgttctctgggttac
cacggcagcagctacagccccgaaggggtggagcccgtcagccctgtgagctcacccagt
ctgacccacgacaaggggctccccaagcacctggaagagctcgacaagagccacctggag
ggggagctgcggcccaagcagccaggccccgtgaagcttggcggggaggccgcccacctc
ccacacctgcggccgctgcctgagagccagccctcgtccagcccgctgctccagaccgcc
ccaggggtcaaaggtcaccagcgggtggtcaccctggcccagcacatcagtgaggtcatc
acacaggactacacccggcaccacccacagcagctcagcgcacccctgcccgcccccctc
tactccttccctggggccagctgccccgtcctggacctccgccgcccacccagtgacctc
tacctcccgcccccggaccatggtgccccggcccgtggctccccccacagcgaagggggc
aagaggtctccagagccaaacaagacgtcggtcttgggtggtggtgaggacggtattgaa
cctgtgtccccaccggagggcatgacggagccagggcactcccggagtgctgtgtacccg
ctgctgtaccgggatggggaacagacggagcccagcaggatgggctccaagtctccaggc
aacaccagccagccgccagccttcttcagcaagctgaccgagagcaactccgccatggtc
aagtccaagaagcaagagatcaacaagaagctgaacacccacaaccggaatgagcctgaa
tacaatatcagccagcctgggacggagatcttcaatatgcccgccatcaccggaacaggc
cttatgacctatagaagccaggcggtgcaggaacatgccagcaccaacatggggctggag
gccataattagaaaggcactcatgggtaaatatgaccagtgggaagagtccccgccgctc
agcgccaatgcttttaaccctctgaatgccagtgccagcctgcccgctgctatgcccata
accgctgctgacggacggagtgaccacacactcacctcgccaggtggcggcgggaaggcc
aaggtctctggcagacccagcagccgaaaagccaagtccccggccccgggcctggcatct
ggggaccggccaccctctgtctcctcagtgcactcggagggagactgcaaccgccggacg
ccgctcaccaaccgcgtgtgggaggacaggccctcgtccgcaggttccacgccattcccc
tacaaccccctgatcatgcggctgcaggcgggtgtcatggcttccccacccccaccgggc
ctccccgcgggcagcgggcccctcgctggcccccaccacgcctgggacgaggagcccaag
ccactgctctgctcgcagtacgagacactctccgacagcgagtga

DBGET integrated database retrieval system