KEGG   Homo sapiens (human): 9616Help
Entry
9616              CDS       T01001                                 

Gene name
RNF7, CKBBP1, ROC2, SAG
Definition
(RefSeq) ring finger protein 7
  KO
K10611  
RING-box protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Module
ECS complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9616 (RNF7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Ring finger protein
     9616 (RNF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q22-q24
AA seq 113 aa AA seqDB search
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtggaagacggagaggaaacctgcgccctggcctctcactccgggagctca
ggctccaagtcgggaggcgacaagatgttctccctcaagaagtggaacgcggtggccatg
tggagctgggacgtggagtgcgatacgtgcgccatctgcagggtccaggtgatggatgcc
tgtcttagatgtcaagctgaaaacaaacaagaggactgtgttgtggtctggggagaatgt
aatcattccttccacaactgctgcatgtccctgtgggtgaaacagaacaatcgctgccct
ctctgccagcaggactgggtggtccaaagaatcggcaaatga

DBGET integrated database retrieval system