KEGG   Homo sapiens (human): 9616Help
Entry
9616              CDS       T01001                                 

Gene name
RNF7, CKBBP1, ROC2, SAG
Definition
(RefSeq) ring finger protein 7
  KO
K10611  RING-box protein 2 [EC:2.3.2.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Module
hsa_M00388  ECS complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9616 (RNF7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     9616 (RNF7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Ring finger protein
     9616 (RNF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 9616
NCBI-ProteinID: NP_055060
OMIM: 603863
HGNC: 10070
Ensembl: ENSG00000114125
Vega: OTTHUMG00000141305
Pharos: Q9UBF6(Tbio)
UniProt: Q9UBF6
Structure
PDB: 

Jmol
Position
3q23
AA seq 113 aa AA seqDB search
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtggaagacggagaggaaacctgcgccctggcctctcactccgggagctca
ggctccaagtcgggaggcgacaagatgttctccctcaagaagtggaacgcggtggccatg
tggagctgggacgtggagtgcgatacgtgcgccatctgcagggtccaggtgatggatgcc
tgtcttagatgtcaagctgaaaacaaacaagaggactgtgttgtggtctggggagaatgt
aatcattccttccacaactgctgcatgtccctgtgggtgaaacagaacaatcgctgccct
ctctgccagcaggactgggtggtccaaagaatcggcaaatga

DBGET integrated database retrieval system