KEGG   Homo sapiens (human): 962Help
Entry
962               CDS       T01001                                 

Gene name
CD48, BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48
Definition
(RefSeq) CD48 molecule
  KO
K06479  
CD48 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    962 (CD48)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD2; CD2 antigen [KO:K06449]
     962 (CD48)
    CD244; natural killer cell receptor 2B4 [KO:K06582]
     962 (CD48)
Cellular antigens [BR:hsa04090]
 Proteins
  962 (CD48)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  962 (CD48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P09326(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 243 aa AA seqDB search
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFY
TFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE
WKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSV
LETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGL
LLT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccagaggttgggattcgtgtctggctctggaattgctactgctgcctctgtca
ctcctggtgaccagcattcaaggtcacttggtacatatgaccgtggtctccggcagcaac
gtgactctgaacatctctgagagcctgcctgagaactacaaacaactaacctggttttat
actttcgaccagaagattgtagaatgggattccagaaaatctaagtactttgaatccaaa
tttaaaggcagggtcagacttgatcctcagagtggcgcactgtacatctctaaggtccag
aaagaggacaacagcacctacatcatgagggtgttgaaaaagactgggaatgagcaagaa
tggaagatcaagctgcaagtgcttgaccctgtacccaagcctgtcatcaaaattgagaag
atagaagacatggatgacaactgttatctgaaactgtcatgtgtgatacctggcgagtct
gtaaactacacctggtatggggacaaaaggcccttcccaaaggagctccagaacagtgtg
cttgaaaccacccttatgccacataattactccaggtgttatacttgccaagtcagcaat
tctgtgagcagcaagaatggcacggtctgcctcagtccaccctgtaccctggcccggtcc
tttggagtagaatggattgcaagttggctagtggtcacggtgcccaccattcttggcctg
ttacttacctga

DBGET integrated database retrieval system