KEGG   Homo sapiens (human): 9620Help
Entry
9620              CDS       T01001                                 

Gene name
CELSR1, ADGRC1, CDHF9, FMI2, HFMI2, ME2
Definition
(RefSeq) cadherin EGF LAG seven-pass G-type receptor 1
  KO
K04600  
cadherin EGF LAG seven-pass G-type receptor 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Cell adhesion
   Cadherin EGF LAG (CELSR)
    9620 (CELSR1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Flamingos
   CELSR1; cadherin EGF LAG seven-pass G-type receptor 1 [KO:K04600]
    9620 (CELSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.3
AA seq 3014 aa AA seqDB search
MAPPPPPVLPVLLLLAAAAALPAMGLRAAAWEPRVPGGTRAFALRPGCTYAVGAACTPRA
PRELLDVGRDGRLAGRRRVSGAGRPLPLQVRLVARSAPTALSRRLRARTHLPGCGARARL
CGTGARLCGALCFPVPGGCAAAQHSALAAPTTLPACRCPPRPRPRCPGRPICLPPGGSVR
LRLLCALRRAAGAVRVGLALEAATAGTPSASPSPSPPLPPNLPEARAGPARRARRGTSGR
GSLKFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDS
ATGAVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRE
RVRENLEVGYEVLTIRASDRDSPINANLRYRVLGGAWDVFQLNESSGVVSTRAVLDREEA
AEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLR
VQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGG
RPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARL
HYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAV
DHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDANSVI
TYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGTRSHTAHVLINVT
DANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQFRIDPD
SGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGS
IFEDAPPSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDREN
VAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAK
IRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVELDFEVRREYVLVVQATSAP
LVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSNSFPTGVIGCIPAHDPDVSDSLNY
TFVQGNELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDGIHSVTAFCTLRVTIITD
DMLTNSITVRLENMSQEKFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNILNV
TFSALLPGGVRGQFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVS
VLRFDSSAPFLSSTTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSDPCGANGRCRS
REGGYTCECFEDFTGEHCEVDARSGRCANGVCKNGGTCVNLLIGGFHCVCPPGEYERPYC
EVTTRSFPPQSFVTFRGLRQRFHFTISLTFATQERNGLLLYNGRFNEKHDFIALEIVDEQ
VQLTFSAGETTTTVAPKVPSGVSDGRWHSVQVQYYNKPNIGHLGLPHGPSGEKMAVVTVD
DCDTTMAVRFGKDIGNYSCAAQGTQTGSKKSLDLTGPLLLGGVPNLPEDFPVHNRQFVGC
MRNLSVDGKNVDMAGFIANNGTREGCAARRNFCDGRRCQNGGTCVNRWNMYLCECPLRFG
GKNCEQAMPHPQLFSGESVVSWSDLNIIISVPWYLGLMFRTRKEDSVLMEATSGGPTSFR
LQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDY
GMDQNKADIGGMLPGLTVRSVVVGGASEDKVSVRRGFRGCMQGVRMGGTPTNVATLNMNN
ALKVRVKDGCDVDDPCTSSPCPPNSRCHDAWEDYSCVCDKGYLGINCVDACHLNPCENMG
ACVRSPGSPQGYVCECGPSHYGPYCENKLDLPCPRGWWGNPVCGPCHCAVSKGFDPDCNK
TNGQCQCKENYYKLLAQDTCLPCDCFPHGSHSRTCDMATGQCACKPGVIGRQCNRCDNPF
AEVTTLGCEVIYNGCPKAFEAGIWWPQTKFGQPAAVPCPKGSVGNAVRHCSGEKGWLPPE
LFNCTTISFVDLRAMNEKLSRNETQVDGARALQLVRALRSATQHTGTLFGNDVRTAYQLL
GHVLQHESWQQGFDLAATQDADFHEDVIHSGSALLAPATRAAWEQIQRSEGGTAQLLRRL
EGYFSNVARNVRRTYLRPFVIVTANMILAVDIFDKFNFTGARVPRFDTIHEEFPRELESS
VSFPADFFRPPEEKEGPLLRPAGRRTTPQTTRPGPGTEREAPISRRRRHPDDAGQFAVAL
VIIYRTLGQLLPERYDPDRRSLRLPHRPIINTPMVSTLVYSEGAPLPRPLERPVLVEFAL
LEVEERTKPVCVFWNHSLAVGGTGGWSARGCELLSRNRTHVACQCSHTASFAVLMDISRR
ENGEVLPLKIVTYAAVSLSLAALLVAFVLLSLVRMLRSNLHSIHKHLAVALFLSQLVFVI
GINQTENPFLCTVVAILLHYIYMSTFAWTLVESLHVYRMLTEVRNIDTGPMRFYYVVGWG
IPAIVTGLAVGLDPQGYGNPDFCWLSLQDTLIWSFAGPIGAVIIINTVTSVLSAKVSCQR
KHHYYGKKGIVSLLRTAFLLLLLISATWLLGLLAVNRDALSFHYLFAIFSGLQGPFVLLF
HCVLNQEVRKHLKGVLGGRKLHLEDSATTRATLLTRSLNCNTTFGDGPDMLRTDLGESTA
SLDSIVRDEGIQKLGVSSGLVRGSHGEPDASLMPRSCKDPPGHDSDSDSELSLDEQSSSY
ASSHSSDSEDDGVGAEEKWDPARGAVHSTPKGDAVANHVPAGWPDQSLAESDSEDPSGKP
RLKVETKVSVELHREEQGSHRGEYPPDQESGGAARLASSQPPEQRKGILKNKVTYPPPLT
LTEQTLKGRLREKLADCEQSPTSSRTSSLGSGGPDCAITVKSPGREPGRDHLNGVAMNVR
TGSAQADGSDSEKP
NT seq 9045 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgccgccgccgcccgtgctgcccgtgctgctgctcctggccgccgccgccgcc
ctgccggcgatggggctgcgagcggccgcctgggagccgcgcgtacccggcgggacccgc
gccttcgccctccggcccggctgtacctacgcggtgggcgccgcttgcacgccccgggcg
ccgcgggagctgctggacgtgggccgcgatgggcggctggcaggacgtcggcgcgtctcg
ggcgcggggcgcccgctgccgctgcaagtccgcttggtggcccgcagtgccccgacggcg
ctgagccgccgcctgcgggcgcgcacgcaccttcccggctgcggagcccgtgcccggctc
tgcggaaccggtgcccggctctgcggggcgctctgcttccccgtccccggcggctgcgcg
gccgcgcagcattcggcgctcgcagctccgaccaccttacccgcctgccgctgcccgccg
cgccccaggccccgctgtcccggccgtcccatctgcctgccgccgggcggctcggtccgc
ctgcgtctgctgtgcgccctgcggcgcgcggctggcgccgtccgggtgggactggcgctg
gaggccgccaccgcggggacgccctccgcgtcgccatccccatcgccgcccctgccgccg
aacttgcccgaagcccgggcggggccggcgcgacgggcccggcggggcacgagcggcaga
gggagcctgaagtttccgatgcccaactaccaggtggcgttgtttgagaacgaaccggcg
ggcaccctcatcctccagctgcacgcgcactacaccatcgagggcgaggaggagcgcgtg
agctattacatggaggggctgttcgacgagcgctcccggggctacttccgaatcgactct
gccacgggcgccgtgagcacggacagcgtactggaccgcgagaccaaggagacgcacgtc
ctcagggtgaaagccgtggactacagtacgccgccgcgctcggccaccacctacatcact
gtcttggtcaaagacaccaacgaccacagcccggtcttcgagcagtcggagtaccgcgag
cgcgtgcgggagaacctggaggtgggctacgaggtgctgaccatccgcgccagcgaccgc
gactcgcccatcaacgccaacttgcgttaccgcgtgttggggggcgcgtgggacgtcttc
cagctcaacgagagctctggcgtggtgagcacacgggcggtgctggaccgggaggaggcg
gccgagtaccagctcctggtggaggccaacgaccaggggcgcaatccgggcccgctcagt
gccacggccaccgtgtacatcgaggtggaggacgagaacgacaactacccccagttcagc
gagcagaactacgtggtccaggtgcccgaggacgtggggctcaacacggctgtgctgcga
gtgcaggccacggaccgggaccagggccagaacgcggccattcactacagcatcctcagc
gggaacgtggccggccagttctacctgcactcgctgagcgggatcctggatgtgatcaac
cccttggatttcgaggatgtccagaaatactcgctgagcattaaggcccaggatgggggc
cggcccccgctcatcaattcttcaggggtggtgtctgtgcaggtgctggatgtcaacgac
aacgagcctatctttgtgagcagccccttccaggccacggtgctggagaatgtgcccctg
ggctaccccgtggtgcacattcaggcggtggacgcggactctggagagaacgcccggctg
cactatcgcctggtggacacggcctccacctttctggggggcggcagcgctgggcctaag
aatcctgcccccacccctgacttccccttccagatccacaacagctccggttggatcaca
gtgtgtgccgagctggaccgcgaggaggtggagcactacagcttcggggtggaggcggtg
gaccacggctcgccccccatgagctcctccaccagcgtgtccatcacggtgctggacgtg
aatgacaacgacccggtgttcacgcagcccacctacgagcttcgtctgaatgaggatgcg
gccgtggggagcagcgtgctgaccctgcaggcccgcgaccgtgacgccaacagtgtgatt
acctaccagctcacaggcggcaacacccggaaccgctttgcactcagcagccagagaggg
ggcggcctcatcaccctggcgctacctctggactacaagcaggagcagcagtacgtgctg
gcggtgacagcatccgacggcacacggtcgcacactgcgcatgtcctaatcaacgtcact
gatgccaacacccacaggcctgtctttcagagctcccattacacagtgagtgtcagtgag
gacaggcctgtgggcacctccattgctaccctcagtgccaacgatgaggacacaggagag
aatgcccgcatcacctacgtgattcaggaccccgtgccgcagttccgcattgaccccgac
agtggcaccatgtacaccatgatggagctggactatgagaaccaggtcgcctacacgctg
accatcatggcccaggacaacggcatcccgcagaaatcagacaccaccaccctagagatc
ctcatcctcgatgccaatgacaatgcaccccagttcctgtgggatttctaccagggttcc
atctttgaggatgctccaccctcgaccagcatcctccaggtctctgccacggaccgggac
tcaggtcccaatgggcgtctgctgtacaccttccagggtggggacgacggcgatggggac
ttctacatcgagcccacgtccggtgtgattcgcacccagcgccggctggaccgggagaat
gtggccgtgtacaacctttgggctctggctgtggatcggggcagtcccactccccttagc
gcctcggtagaaatccaggtgaccatcttggacattaatgacaatgcccccatgtttgag
aaggacgaactggagctgtttgttgaggagaacaacccagtggggtcggtggtggcaaag
attcgtgctaacgaccctgatgaaggccctaatgcccagatcatgtatcagattgtggaa
ggggacatgcggcatttcttccagctggacctgctcaacggggacctgcgtgccatggtg
gagctggactttgaggtccggcgggagtatgtgctggtggtgcaggccacgtcggctccg
ctggtgagccgagccacggtgcacatccttctcgtggaccagaatgacaacccgcctgtg
ctgcccgacttccagatcctcttcaacaactatgtcaccaacaagtccaacagtttcccc
accggcgtgatcggctgcatcccggcccatgaccccgacgtgtcagacagcctcaactac
accttcgtgcagggcaacgagctgcgcctgttgctgctggaccccgccacgggcgaactg
cagctcagccgcgacctggacaacaaccggccgctggaggcgctcatggaggtgtctgtg
tctgatggcatccacagcgtcacggccttctgcaccctgcgtgtcaccatcatcacggac
gacatgctgaccaacagcatcactgtccgcctggagaacatgtcccaggagaagttcctg
tccccgctgctggccctcttcgtggagggggtggccgccgtgctgtccaccaccaaggac
gacgtcttcgtcttcaacgtccagaacgacaccgacgtcagctccaacatcctgaacgtg
accttctcggcgctgctgcctggcggcgtccgcggccagttcttcccgtcggaggacctg
caggagcagatctacctgaatcggacgctgctgaccaccatctccacgcagcgcgtgctg
cccttcgacgacaacatctgcctgcgcgagccctgcgagaactacatgaagtgcgtgtcc
gttctgcgattcgacagctccgcgcccttcctcagctccaccaccgtgctcttccggccc
atccaccccatcaacggcctgcgctgccgctgcccgcccggcttcaccggcgactactgc
gagacggagatcgacctctgctactccgacccgtgcggcgccaacggccgctgccgcagc
cgcgagggcggctacacctgcgagtgcttcgaggacttcactggagagcactgtgaggtg
gatgcccgctcaggccgctgtgccaacggggtgtgcaagaacgggggcacctgcgtgaac
ctgctcatcggcggcttccactgcgtgtgtcctcctggcgagtatgagaggccctactgt
gaggtgaccaccaggagcttcccgccccagtccttcgtcaccttccggggcctgagacag
cgcttccacttcaccatctccctcacgtttgccactcaggaaaggaacggcttgcttctc
tacaacggccgcttcaatgagaagcacgacttcatcgccctggagatcgtggacgagcag
gtgcagctcaccttctctgcaggcgagacaacaacgaccgtggcaccgaaggttcccagt
ggtgtgagtgacgggcggtggcactctgtgcaggtgcagtactacaacaagcccaatatt
ggccacctgggcctgccccatgggccgtccggggaaaagatggccgtggtgacagtggat
gattgtgacacaaccatggctgtgcgctttggaaaggacatcgggaactacagctgcgct
gcccagggcactcagaccggctccaagaagtccctggatctgaccggccctctactcctg
gggggtgtccccaacctgccagaagacttcccagtgcacaaccggcagttcgtgggctgc
atgcggaacctgtcagtcgacggcaaaaatgtggacatggccggattcatcgccaacaat
ggcacccgggaaggctgcgctgctcggaggaacttctgcgatgggaggcggtgtcagaat
ggaggcacctgtgtcaacaggtggaatatgtatctgtgtgagtgtccactccgattcggc
gggaagaactgtgagcaagccatgcctcacccccagctcttcagcggtgagagcgtcgtg
tcctggagtgacctgaacatcatcatctctgtgccctggtacctggggctcatgttccgg
acccggaaggaggacagcgttctgatggaggccaccagtggtgggcccaccagctttcgc
ctccagatcctgaacaactacctccagtttgaggtgtcccacggcccctccgatgtggag
tccgtgatgctgtccgggttgcgggtgaccgacggggagtggcaccacctgctgatcgag
ctgaagaatgttaaggaggacagtgagatgaagcacctggtcaccatgaccttggactat
gggatggaccagaacaaggcagatatcgggggcatgcttcccgggctgacggtaaggagc
gtggtggtcggaggcgcctctgaagacaaggtctccgtgcgccgtggattccgaggctgc
atgcagggagtgaggatgggggggacgcccaccaacgtcgccaccctgaacatgaacaac
gcactcaaggtcagggtgaaggacggctgtgatgtggacgacccctgtacctcgagcccc
tgtccccccaatagccgctgccacgacgcctgggaggactacagctgcgtctgtgacaaa
gggtaccttggaataaactgtgtggatgcctgtcacctgaacccctgcgagaacatgggg
gcctgcgtgcgctcccccggctccccgcagggctacgtgtgcgagtgtgggcccagtcac
tacgggccgtactgtgagaacaaactcgaccttccgtgccccagaggctggtgggggaac
cccgtctgtggaccctgccactgtgccgtcagcaaaggctttgatcccgactgtaataag
accaacggccagtgccaatgcaaggagaattactacaagctcctagcccaggacacctgt
ctgccctgcgactgcttcccccatggctcccacagccgcacttgcgacatggccaccggg
cagtgtgcctgcaagcccggcgtcatcggccgccagtgcaaccgctgcgacaacccgttt
gccgaggtcaccacgctcggctgtgaagtgatctacaatggctgtcccaaagcatttgag
gccggcatctggtggccacagaccaagttcgggcagccggctgcggtgccatgccctaag
ggatccgttggaaatgcggtccgacactgcagcggggagaagggctggctgcccccagag
ctctttaactgtaccaccatctccttcgtggacctcagggccatgaatgagaagctgagc
cgcaatgagacgcaggtggacggcgccagggccctgcagctggtgagggcgctgcgcagt
gctacacagcacacgggcacgctctttggcaatgacgtgcgcacggcctaccagctgctg
ggccacgtccttcagcacgagagctggcagcagggcttcgacctggcagccacgcaggac
gccgactttcacgaggacgtcatccactcgggcagcgccctcctggccccagccaccagg
gcggcgtgggagcagatccagcggagcgagggcggcacggcacagctgctccggcgcctc
gagggctacttcagcaacgtggcacgcaacgtgcggcggacgtacctgcggcccttcgtc
atcgtcaccgccaacatgattcttgctgtcgacatctttgacaagttcaactttacggga
gccagggtcccgcgattcgacaccatccatgaagagttccccagggagctggagtcctcc
gtctccttcccagccgacttcttcagaccacctgaagaaaaagaaggccccctgctgagg
ccggctggccggaggaccaccccgcagaccacgcgcccggggcctggcaccgagagggag
gccccgatcagcaggcggaggcgacaccctgatgacgctggccagttcgccgtcgctctg
gtcatcatttaccgcaccctggggcagctcctgcccgagcgctacgaccccgaccgtcgc
agcctccggttgcctcaccggcccatcattaataccccgatggtgagcacgctggtgtac
agcgagggggctccgctcccgagacccctggagaggcccgtcctggtggagttcgccctg
ctggaggtggaggagcgaaccaagcctgtctgcgtgttctggaaccactccctggccgtt
ggtgggacgggagggtggtctgcccggggctgcgagctcctgtccaggaaccggacacat
gtcgcctgccagtgcagccacacagccagctttgcggtgctcatggatatctccaggcgt
gagaacggggaggtcctgcctctgaagattgtcacctatgccgctgtgtccttgtcactg
gcagccctgctggtggccttcgtcctcctgagcctggtccgcatgctgcgctccaacctg
cacagcattcacaagcacctcgccgtggcgctcttcctctctcagctggtgttcgtgatt
gggatcaaccagacggaaaacccgtttctgtgcacagtggttgccatcctcctccactac
atctacatgagcacctttgcctggaccctcgtggagagcctgcatgtctaccgcatgctg
accgaggtgcgcaacatcgacacggggcccatgcggttctactacgtcgtgggctggggc
atcccggccattgtcacaggactggcggtcggcctggacccccagggctacgggaacccc
gacttctgctggctgtcgcttcaagacaccctgatttggagctttgcggggcccatcgga
gctgttataatcatcaacacagtcacttctgtcctatctgcaaaggtttcctgccaaaga
aagcaccattattatgggaaaaaagggatcgtctccctgctgaggaccgcattcctcctg
ctgctgctcatcagcgccacctggctgctggggctgctggctgtgaaccgcgatgcactg
agctttcactacctcttcgccatcttcagcggcttacagggccccttcgtcctccttttc
cactgcgtgctcaaccaggaggtccggaagcacctgaagggcgtgctcggcgggaggaag
ctgcacctggaggactccgccaccaccagggccaccctgctgacgcgctccctcaactgc
aacaccaccttcggtgacgggcctgacatgctgcgcacagacttgggcgagtccaccgcc
tcgctggacagcatcgtcagggatgaagggatccagaagctcggcgtgtcctctgggctg
gtgaggggcagccacggagagccagacgcgtccctcatgcccaggagctgcaaggatccc
cctggccacgattccgactcagatagcgagctgtccctggatgagcagagcagctcttac
gcctcctcacactcgtcagacagcgaggacgatggggtgggagctgaggaaaaatgggac
ccggccaggggcgccgtccacagcacccccaaaggggacgctgtggccaaccacgttccg
gccggctggcccgaccagagcctggctgagagtgacagtgaggaccccagcggcaagccc
cgcctgaaggtggagaccaaggtcagcgtggagctgcaccgcgaggagcagggcagtcac
cgtggagagtaccccccggaccaggagagcgggggcgcagccaggcttgctagcagccag
cccccagagcagaggaaaggcatcttgaaaaataaagtcacctacccgccgccgctgacg
ctgacggagcagacgctgaagggccggctccgggagaagctggccgactgtgagcagagc
cccacatcctcgcgcacgtcttccctgggctctggcggccccgactgcgccatcacagtc
aagagccctgggagggagccggggcgtgaccacctcaacggggtggccatgaatgtgcgc
actgggagcgcccaggccgatggctccgactctgagaaaccgtga

DBGET integrated database retrieval system