KEGG   Homo sapiens (human): 9622Help
Entry
9622              CDS       T01001                                 

Gene name
KLK4, AI2A1, ARM1, EMSP, EMSP1, KLK-L1, PRSS17, PSTS, kallikrein
Definition
kallikrein-related peptidase 4
Orthology
K08666  
kallikrein 4 (prostase, enamel matrix, prostate) [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Disease
H00615  
Amelogenesis imperfecta
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     9622 (KLK4)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   9622 (KLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.41
AA seq 254 aa AA seqDB search
MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVL
VHPQWVLSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLI
KLDESVSESDTIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSK
LYDPLYHPSMFCAGGGHDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNL
CKFTEWIEKTVQAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcaggaaatccctggggctggttcctggggtacctcatccttggtgtcgca
ggatcgctcgtctctggtagctgcagccaaatcataaacggcgaggactgcagcccgcac
tcgcagccctggcaggcggcactggtcatggaaaacgaattgttctgctcgggcgtcctg
gtgcatccgcagtgggtgctgtcagccgcacactgtttccagaactcctacaccatcggg
ctgggcctgcacagtcttgaggccgaccaagagccagggagccagatggtggaggccagc
ctctccgtacggcacccagagtacaacagacccttgctcgctaacgacctcatgctcatc
aagttggacgaatccgtgtccgagtctgacaccatccggagcatcagcattgcttcgcag
tgccctaccgcggggaactcttgcctcgtttctggctggggtctgctggcgaacggcaga
atgcctaccgtgctgcagtgcgtgaacgtgtcggtggtgtctgaggaggtctgcagtaag
ctctatgacccgctgtaccaccccagcatgttctgcgccggcggagggcacgaccagaag
gactcctgcaacggtgactctggggggcccctgatctgcaacgggtacttgcagggcctt
gtgtctttcggaaaagccccgtgtggccaagttggcgtgccaggtgtctacaccaacctc
tgcaaattcactgagtggatagagaaaaccgtccaggccagttaa

DBGET integrated database retrieval system