KEGG   Homo sapiens (human): 9626Help
Entry
9626              CDS       T01001                                 

Gene name
GUCA1C, GCAP3
Definition
guanylate cyclase activator 1C
Orthology
K08328  
guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    9626 (GUCA1C)
   04740 Olfactory transduction
    9626 (GUCA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.1
AA seq 209 aa AA seqDB search
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQV
YNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAV
QALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLR
VICNGKQPDMETDSSKSPDKAGLGKVKMK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggggaatggcaaatctatagctggtgatcagaaagcagttcctacacaagagacccat
gtgtggtacagaacatttatgatggaatatccatccggcctgcaaacactacatgaattt
aagacacttttgggtctgcaaggtctgaatcagaaggccaataaacatattgatcaagtt
tataatacctttgacacgaacaaggatggatttgttgactttttggagtttattgctgct
gtaaatctaatcatgcaagaaaaaatggagcaaaaattaaaatggtattttaagctgtat
gatgctgatggaaatggttctattgacaaaaatgaactactggacatgttcatggcggta
caagccctcaatggccagcaaactctgagtcctgaagaattcatcaacttggtgttccat
aagatcgatataaacaatgatggggaattgactttagaagaatttatcaatggcatggca
aaagatcaggatctcctggagattgtttacaagagcttcgacttctccaatgtgctgaga
gtaatctgtaatgggaagcagccagacatggagacagactcctccaaatctcctgacaag
gctggtctagggaaggtgaaaatgaagtag

DBGET integrated database retrieval system