KEGG   Homo sapiens (human): 9627Help
Entry
9627              CDS       T01001                                 

Gene name
SNCAIP, SYPH1, Sph1
Definition
(RefSeq) synuclein alpha interacting protein
  KO
K04558  
synuclein, alpha interacting protein (synphilin)
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    9627 (SNCAIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23.2
AA seq 919 aa AA seqDB search
MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDTQNEDRSVSSSSWNCGISTLITNT
QKPTGIADVYSKFRPVKRVSPLKHQPETLENNESDDQKNQKVVEYQKGGESDLGPQPQEL
GPGDGVGGPPGKSSEPSTSLGELEHYDLDMDEILDVPYIKSSQQLASFTKVTSEKRILGL
CTTINGLSGKACSTGSSESSSSNMAPFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISP
PLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSG
LNRTSSQGPEERSEYLKKVKSILNIVKEGQISLLPHLAADNLDKIHDENGNNLLHIAASQ
GHAECLQHLTSLMGEDCLNERNTEKLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDF
PSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYG
ANVTMQNHAGEKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQ
NQLQQFLEAQKSEGKSLPSSPSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGS
LSASSRARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKR
ELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLM
IKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQ
PSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDK
GRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRK
TDAKGNPASSASKGKNKAA
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccctgaataccttgatttggatgaaattgactttagtgatgacatatcttat
tcagtcacatcactcaagacgatcccagaactgtgccgaagatgtgatacgcaaaacgaa
gacagatcagtttctagctctagctggaattgtggcatctcaactcttattacaaacacg
caaaagcccacaggaatcgctgatgtgtacagtaagttccgcccagtgaagcgggtttcg
ccactgaaacatcagccagagactctggagaacaatgaaagtgatgaccaaaagaaccag
aaagtggttgagtaccagaaagggggtgagtctgacctgggcccccagcctcaggagctt
ggccctggagatggagtgggcggcccaccaggtaagagctctgagcccagcacatcgctg
ggtgaactggagcactacgacctcgacatggatgagattctggatgtgccttatattaaa
tccagtcagcagcttgcctcttttaccaaggtgacttcagaaaaaagaattttgggctta
tgcacaaccatcaatggcctttctggcaaagcctgctctacaggaagttctgagagctca
tcatccaacatggcaccattttgtgttctttctcccgtgaaaagccctcacttgagaaaa
gcatcagctgtcatccacgaccagcacaagctgtccactgaagaaaccgagatctcacct
cctctggttaaatgtggctctgcatatgagcctgaaaaccagagtaaagacttcctaaac
aagacatttagtgatcctcatggtcgaaaagttgagaagacaacaccagactgccagctc
agggccttccacctacaatcctcagcagcagaatccaaaccagaagagcaggtcagtggc
ctaaaccggaccagctcccaaggcccagaagaaaggagtgagtatctgaaaaaagtgaaa
agcatcttgaacattgttaaagaaggacagatctctctcctgccacacctagctgcagac
aatctagacaaaattcacgacgaaaatggaaacaatctattacatattgcggcgtcacag
ggacacgcagagtgtctacagcacctcacttctttgatgggagaagactgcctcaatgag
cgcaacactgagaagttgactccagcaggcctggccattaagaatggtcagttggagtgc
gtacgctggatggtgagcgaaacagaagccattgcagaactgagttgttctaaggatttt
ccaagccttattcattacgcaggttgctatggccaggaaaagattcttctgtggcttctt
cagtttatgcaagaacagggcatctcgttggatgaagtagaccaggatggcaacagtgcc
gttcacgtagcctcacagcatggctaccttggatgcatacagaccttggttgaatatgga
gcaaatgtcaccatgcagaaccacgctggggaaaagccctcccagagcgccgagcggcag
gggcacaccctgtgctccaggtacctggtggtggtggagacctgcatgtcgctggcctct
caagtggtgaagttaaccaagcagctaaaggaacaaacagtagaacgtgtcacgctgcag
aaccaactccaacaatttctagaagcccagaaatcagagggcaagtcactcccttcttca
cccagttcaccatcctcacctgcctccagaaagtcccagtggaaatctccagatgcagat
gatgattctgtagccaaaagcaagccaggagtccaagaggggattcaggttcttggaagc
ctgtcagcctccagccgggctagacccaaagcaaaagatgaagattctgataaaatctta
cgccagttattgggaaaggaaatctcagaaaatgtctgcacccaggaaaaactgtccttg
gaattccaggatgctcaggcttcctctagaaattctaaaaagatcccactggagaagagg
gaactgaagttagccaggctgagacagctgatgcagaggtcactgagtgagtctgacaca
gactccaacaactctgaggaccccaagactaccccagtgaggaaggctgaccgaccaagg
ccgcagcccattgtagaaagcgtagagagtatggacagcgcagaaagcctgcacctgatg
attaagaaacacaccttggcatcagggggacgcaggtttcctttcagcatcaaggcctcc
aaatccctggatggccacagcccatctcccacctcagagagcagcgaaccagacttagaa
tcccagtatccaggctcagggagtattcctccaaaccagccctctggtgaccctcagcag
cccagccctgacagtactgctgcccagaaagttgccacaagtcccaagagtgccctcaag
tctccatcttccaagcgtaggacatctcagaacttaaaactgagagttacctttgaggag
cctgtggtgcagatggagcagcctagccttgaactgaatggagaaaaagacaaagataag
ggcaggactctccagcggacctccacaagtaacgaatcgggggatcaactgaaaaggcct
tttggagcctttcgatctatcatggagacactaagtggcaaccaaaacaataataataac
taccaggcagccaaccagctgaaaacctctacattgcccttgacctcacttgggaggaag
acagatgccaagggaaaccctgccagctccgctagcaaaggaaagaataaggcagcataa

DBGET integrated database retrieval system