KEGG   Homo sapiens (human): 9627Help
Entry
9627              CDS       T01001                                 

Gene name
SNCAIP, SYPH1, Sph1
Definition
synuclein, alpha interacting protein
Orthology
K04558  
synuclein, alpha interacting protein (synphilin)
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Class
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23.2
AA seq 603 aa AA seqDB search
MTYLIQSHHSRRSQNCAEDVIRKTKTDQNGQLECVRWMVSETEAIAELSCSKDFPSLIHY
AGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQ
NHAGEKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQF
LEAQKSEGKSLPSSPSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSR
ARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLAR
LRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLMIKKHTL
ASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQPSPDST
AAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDKGRTLQR
TSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGN
PASSASKGKNKAEMYSSCINLSSNMLIEEHLCNDTRHNDINRKMKKSYSIKHIAEPESKE
LFL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcttattcagtcacatcactcaagacgatcccagaactgtgccgaagatgtg
atacgcaaaacgaagacagatcagaatggtcagttggagtgcgtacgctggatggtgagc
gaaacagaagccattgcagaactgagttgttctaaggattttccaagccttattcattac
gcaggttgctatggccaggaaaagattcttctgtggcttcttcagtttatgcaagaacag
ggcatctcgttggatgaagtagaccaggatggcaacagtgccgttcacgtagcctcacag
catggctaccttggatgcatacagaccttggttgaatatggagcaaatgtcaccatgcag
aaccacgctggggaaaagccctcccagagcgccgagcggcaggggcacaccctgtgctcc
aggtacctggtggtggtggagacctgcatgtcgctggcctctcaagtggtgaagttaacc
aagcagctaaaggaacaaacagtagaacgtgtcacgctgcagaaccaactccaacaattt
ctagaagcccagaaatcagagggcaagtcactcccttcttcacccagttcaccatcctca
cctgcctccagaaagtcccagtggaaatctccagatgcagatgatgattctgtagccaaa
agcaagccaggagtccaagaggggattcaggttcttggaagcctgtcagcctccagccgg
gctagacccaaagcaaaagatgaagattctgataaaatcttacgccagttattgggaaag
gaaatctcagaaaatgtctgcacccaggaaaaactgtccttggaattccaggatgctcag
gcttcctctagaaattctaaaaagatcccactggagaagagggaactgaagttagccagg
ctgagacagctgatgcagaggtcactgagtgagtctgacacagactccaacaactctgag
gaccccaagactaccccagtgaggaaggctgaccgaccaaggccgcagcccattgtagaa
agcgtagagagtatggacagcgcagaaagcctgcacctgatgattaagaaacacaccttg
gcatcagggggacgcaggtttcctttcagcatcaaggcctccaaatccctggatggccac
agcccatctcccacctcagagagcagcgaaccagacttagaatcccagtatccaggctca
gggagtattcctccaaaccagccctctggtgaccctcagcagcccagccctgacagtact
gctgcccagaaagttgccacaagtcccaagagtgccctcaagtctccatcttccaagcgt
aggacatctcagaacttaaaactgagagttacctttgaggagcctgtggtgcagatggag
cagcctagccttgaactgaatggagaaaaagacaaagataagggcaggactctccagcgg
acctccacaagtaacgaatcgggggatcaactgaaaaggccttttggagcctttcgatct
atcatggagacactaagtggcaaccaaaacaataataataactaccaggcagccaaccag
ctgaaaacctctacattgcccttgacctcacttgggaggaagacagatgccaagggaaac
cctgccagctccgctagcaaaggaaagaataaggcagaaatgtacagcagctgcatcaat
ctttcctctaacatgctgattgaagagcatctgtgtaacgacacacggcataatgacatc
aatagaaaaatgaagaaatcctacagcataaagcacattgctgagccagagtcaaaagaa
ctcttcttgtaa

DBGET integrated database retrieval system