KEGG   Homo sapiens (human): 9630Help
Entry
9630              CDS       T01001                                 

Gene name
GNA14
Definition
guanine nucleotide binding protein (G protein), alpha 14
Orthology
K04636  
guanine nucleotide-binding protein subunit alpha-14
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Chagas disease (American trypanosomiasis)
Amoebiasis
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21
AA seq 355 aa AA seqDB search
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSML
SREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccggctgctgctgcctgtccgcggaggagaaggagtcgcagcgcatcagcgcggag
atcgagcgacagcttcgtcgggacaagaaggacgcgcgccgtgagcttaagctgctgctg
ctgggaactggtgaaagtgggaaaagcacctttatcaagcagatgagaattatccatggg
tctggttacagcgacgaagacagaaaggggttcacgaagctggtttaccaaaacatattc
accgccatgcaagccatgatcagagcgatggacacgctaaggatacagtatgtgtgtgaa
cagaataaggaaaatgcccagataatcagagaagtggaagtggacaaggtctccatgctc
tccagggagcaggtggaggccatcaagcagctctggcaagatccaggcatccaggagtgt
tacgacaggaggagggagtaccagctgtcggactctgccaaatattacctgactgacatt
gaccgcatcgccacaccatcattcgtgcctacccaacaagatgtgcttcgcgtccgagtg
cccaccaccggcatcattgagtatccatttgacttggaaaacatcatctttcggatggtg
gatgttggtggccaacgatcggaaagacggaagtggattcactgctttgagagtgtcacc
tccattattttcttggttgctctgagtgaatatgaccaggtcctggctgagtgtgacaac
gagaatcgcatggaagagagcaaagccttatttaaaaccatcatcacctacccctggttt
ctgaattcgtctgtgattttattcttgaacaagaaggatcttttggaagagaaaatcatg
tactctcatctaattagctatttcccagaatacacaggaccgaaacaggatgtcagagct
gccagagactttatcctgaagctttaccaagatcagaatcctgacaaagagaaagtcatc
tactctcacttcacatgtgctacagatacagacaatattcgctttgtgtttgctgctgtc
aaagacacaattctacagctaaacctaagggaattcaaccttgtctaa

DBGET integrated database retrieval system