KEGG   Homo sapiens (human): 9655Help
Entry
9655              CDS       T01001                                 

Gene name
SOCS5, CIS6, CISH6, Cish5, SOCS-5
Definition
suppressor of cytokine signaling 5
Orthology
K04698  
suppressor of cytokine signaling 5
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Module
ECS complex
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    9655 (SOCS5)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    9655 (SOCS5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECS complex
    target recognizing subunit (SOCS box)
     9655 (SOCS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p21
AA seq 536 aa AA seqDB search
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtgggaaaaatgtggaataacttcaaatacaggtgtcagaatctcttcggt
catgagggaggaagccgtagtgaaaatgtggacatgaactccaacagatgtttgtctgtc
aaagagaaaaacatcagcataggagactcaactcctcagcaacaaagcagtcccttaaga
gaaaatattgccttacaactgggattaagcccttcgaagaattcttcaaggagaaatcaa
aattgtgccacagaaatccctcaaattgttgaaataagcatcgaaaaggataatgattct
tgtgttaccccaggaacaagacttgcacgaagagattcctactctcgacatgctccatgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattggatgctgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctacggcgtaagttct
gtacacgacatggacagtgtttccagcagaactgtaggaagtcgctctctaagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaagcct
ctcttttccaataaaagaaaaatccatctctctgaattaatgcttgagaaatgccctttt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactggga
ccaaaattagctcctggaatgactgaaataagtggggacagttctgcaattccacaagct
aattgtgactcggaagaggatacaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcagatatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattacatacactgcctcgtgcctgatttgcttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttctcgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccgc
cgctacaacagatccctgcatgcccgaattgagcagtggaatcacaactttagtttcgac
gcccatgacccgtgtgtatttcactcctccactgtaacgggacttttagaacattataaa
gatcccagttcgtgcatgttttttgaaccattgcttactatatcactaaataggactttc
ccttttagcctgcagtatatctgtcgcgcggtaatctgcaggtgcactacgtatgatgga
attgatgggctccctctaccctcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttggaacgagaaccagtcaaggcaaagtaa

DBGET integrated database retrieval system