KEGG   Homo sapiens (human): 967Help
Entry
967               CDS       T01001                                 

Gene name
CD63, LAMP-3, ME491, MLA1, OMA81H, TSPAN30
Definition
CD63 molecule
Orthology
K06497  
CD63 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Proteoglycans in cancer
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q12-q13
AA seq 238 aa AA seqDB search
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggaaggaggaatgaaatgtgtgaagttcttgctctacgtcctcctgctggcc
ttttgcgcctgtgcagtgggactgattgccgtgggtgtcggggcacagcttgtcctgagt
cagaccataatccagggggctacccctggctctctgttgccagtggtcatcatcgcagtg
ggtgtcttcctcttcctggtggcttttgtgggctgctgcggggcctgcaaggagaactat
tgtcttatgatcacgtttgccatctttctgtctcttatcatgttggtggaggtggccgca
gccattgctggctatgtgtttagagataaggtgatgtcagagtttaataacaacttccgg
cagcagatggagaattacccgaaaaacaaccacactgcttcgatcctggacaggatgcag
gcagattttaagtgctgtggggctgctaactacacagattgggagaaaatcccttccatg
tcgaagaaccgagtccccgactcctgctgcattaatgttactgtgggctgtgggattaat
ttcaacgagaaggcgatccataaggagggctgtgtggagaagattgggggctggctgagg
aaaaatgtgctggtggtagctgcagcagcccttggaattgcttttgtcgaggttttggga
attgtctttgcctgctgcctcgtgaagagtatcagaagtggctacgaggtgatgtag

DBGET integrated database retrieval system