KEGG   Homo sapiens (human): 967Help
Entry
967               CDS       T01001                                 

Gene name
CD63, LAMP-3, ME491, MLA1, OMA81H, TSPAN30
Definition
CD63 molecule
Orthology
K06497  
CD63 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    967 (CD63)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    967 (CD63)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   967 (CD63)
Cellular antigens [BR:hsa04090]
 Proteins
  967 (CD63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q12-q13
AA seq 238 aa AA seqDB search
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggaaggaggaatgaaatgtgtgaagttcttgctctacgtcctcctgctggcc
ttttgcgcctgtgcagtgggactgattgccgtgggtgtcggggcacagcttgtcctgagt
cagaccataatccagggggctacccctggctctctgttgccagtggtcatcatcgcagtg
ggtgtcttcctcttcctggtggcttttgtgggctgctgcggggcctgcaaggagaactat
tgtcttatgatcacgtttgccatctttctgtctcttatcatgttggtggaggtggccgca
gccattgctggctatgtgtttagagataaggtgatgtcagagtttaataacaacttccgg
cagcagatggagaattacccgaaaaacaaccacactgcttcgatcctggacaggatgcag
gcagattttaagtgctgtggggctgctaactacacagattgggagaaaatcccttccatg
tcgaagaaccgagtccccgactcctgctgcattaatgttactgtgggctgtgggattaat
ttcaacgagaaggcgatccataaggagggctgtgtggagaagattgggggctggctgagg
aaaaatgtgctggtggtagctgcagcagcccttggaattgcttttgtcgaggttttggga
attgtctttgcctgctgcctcgtgaagagtatcagaagtggctacgaggtgatgtag

DBGET integrated database retrieval system