KEGG   Homo sapiens (human): 967Help
Entry
967               CDS       T01001                                 

Gene name
CD63, LAMP-3, ME491, MLA1, OMA81H, TSPAN30
Definition
(RefSeq) CD63 molecule
  KO
K06497  CD63 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    967 (CD63)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    967 (CD63)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   967 (CD63)
CD molecules [BR:hsa04090]
 Proteins
  967 (CD63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspannin
Motif
Other DBs
NCBI-GeneID: 967
NCBI-ProteinID: NP_001244318
OMIM: 155740
HGNC: 1692
Ensembl: ENSG00000135404
Vega: OTTHUMG00000170454
Pharos: P08962(Tbio)
UniProt: P08962 A0A024RB05
Position
12q13.2
AA seq 238 aa AA seqDB search
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggaaggaggaatgaaatgtgtgaagttcttgctctacgtcctcctgctggcc
ttttgcgcctgtgcagtgggactgattgccgtgggtgtcggggcacagcttgtcctgagt
cagaccataatccagggggctacccctggctctctgttgccagtggtcatcatcgcagtg
ggtgtcttcctcttcctggtggcttttgtgggctgctgcggggcctgcaaggagaactat
tgtcttatgatcacgtttgccatctttctgtctcttatcatgttggtggaggtggccgca
gccattgctggctatgtgtttagagataaggtgatgtcagagtttaataacaacttccgg
cagcagatggagaattacccgaaaaacaaccacactgcttcgatcctggacaggatgcag
gcagattttaagtgctgtggggctgctaactacacagattgggagaaaatcccttccatg
tcgaagaaccgagtccccgactcctgctgcattaatgttactgtgggctgtgggattaat
ttcaacgagaaggcgatccataaggagggctgtgtggagaagattgggggctggctgagg
aaaaatgtgctggtggtagctgcagcagcccttggaattgcttttgtcgaggttttggga
attgtctttgcctgctgcctcgtgaagagtatcagaagtggctacgaggtgatgtag

DBGET integrated database retrieval system