KEGG   Homo sapiens (human): 96764Help
Entry
96764             CDS       T01001                                 

Gene name
TGS1, NCOA6IP, PIMT, PIPMT
Definition
trimethylguanosine synthase 1 (EC:2.1.1.-)
Orthology
K14292  
trimethylguanosine synthase [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    96764 (TGS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     96764 (TGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q11
AA seq 853 aa AA seqDB search
MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQAT
EEEEGGYSCGTAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRN
KVKIKKKKHQKKYLDEIVQESWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETE
NPPVENTLSPKLEITEKWEKYWNEYGGGLLWQSWQEKHPGQALSSEPWNFPDTKEEWEQH
YSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPI
MVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSEVSSKRECPAS
GQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHK
PSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSK
YLDMRRQIKMKNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNV
HDASTSSDSEEQDMSVKKGDDLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQ
DCVTQEVPDSRQAETEAEVKKKKNKKKNKKVNGLPPEIAAVPELAKYWAQRYRLFSRFDD
GIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDI
DPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIR
TMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITA
YFGDLIRRPASET
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgcgagaagtggagccgcgtggcggaaatgtttctcttcattgaggagcgggag
gattgtaagatactgtgcctttgctccagggcatttgtggaggatcgaaaattgtacaat
ttgggattaaaaggctattacatcagagacagtggcaacaattcaggagaccaggcgaca
gaagaagaggaaggtggttattcctgtggtactgcagaatcacatgacagcaaaggcata
ggcctggatgaaagtgaacttgattctgaggctgaactcatgagaagtatgggattgcca
cttcaatttggtaggataactgcacataaggattttgaggtatctatgaatactagaaat
aaagttaaaataaaaaagaaaaaacatcaaaagaaatacttagatgaaattgtgcaagaa
tcttggagaaaagaatatgaagaagacgacattttggcttcagatgatccatcttcaatt
gaacagtatgagaacaccagaacatatgaacttcaaagcaaaaaagatactgagacagaa
aatcctccagttgaaaacacattatctccaaagctagaaattacagagaaatgggaaaag
tattggaatgaatatggaggaggactattgtggcaaagttggcaagaaaaacatccgggt
caagcactatcttctgaaccttggaactttcctgatacaaaggaagaatgggagcaacat
tatagtcaactttattggtattatttggaacaatttcagtattgggaagctcagggttgg
acttttgatgcctcgcaaagctgtgatacagatacttacacatctaaaacagaagctgat
gacaagaacgatgaaaaatgcatgaaagttgacttagtatcttttccatcttcacctatt
atggttgataatgatagctctggtacaagtgataaggatcatagtgaaatacttgatgga
attagtaacataaaactgaattcagaggaagtaacacagagccaattagattcctgtaca
agtcatgatggtcatcaacagctaagtgaagttagtagcaaaagagagtgccctgcttcc
ggccaaagtgaaccacgtaatggaggaaccaatgaggaaagcaactcatcggggaataca
aacacagacccaccagctgaggattcacagaagtcttcaggagcaaacacaagcaaagac
agaccacatgccagtggtactgatggagatgaaagtgaggaagacccacctgagcataag
ccaagcaaactgaagaggagccatgaactggacattgatgaaaacccagcttcagacttt
gatgacagtggttcccttctaggattcaagtatggctcaggacaaaaatatggtggaatc
ccaaatttcagtcatcggcaggtcaggtatttagagaagaatgtgaagcttaagtctaag
tacctagacatgcgcagacaaataaagatgaaaaacaaacacatcttctttaccaaagag
tcagaaaaaccatttttcaagaaaagcaaaattctgagtaaggtagaaaaattcctcaca
tgggttaataaaccaatggatgaagaagcatcacaggaatcatcttctcatgacaatgtg
cacgacgcttccacaagtagtgattcagaggaacaagacatgtctgttaaaaaaggtgat
gacctactggagactaataatccagaacctgaaaagtgtcagagcgtatcttcagctggt
gaacttgaaacagaaaactatgaaagagacagcttgctagcaactgttccagatgagcag
gattgtgttactcaagaagtgccagactcccgccaggcagaaactgaagctgaagtgaaa
aagaagaagaacaagaagaagaacaaaaaggtgaatggtctgcctcctgaaatagctgct
gttcctgagctggcaaaatactgggcccagaggtacaggctcttctcccgttttgatgat
gggattaagttggacagagagggctggttttcagttacacccgagaagattgctgaacac
attgctggccgtgttagtcagtccttcaagtgtgacgttgtagtagacgcattctgtgga
gttggaggaaataccattcagtttgccttaacaggaatgagagtgattgccattgatatc
gatcctgttaagattgcccttgctcgcaataatgcagaagtttatgggatagcagataag
atagagttcatctgtggagatttcttgctgctggcttcttttttaaaggctgatgttgtg
ttcctcagcccaccttggggagggccagactatgccactgcagagacctttgacattaga
acaatgatgtctcctgatggctttgaaattttcagactttctaagaagatcactaataat
attgtttattttcttccaagaaatgctgatattgaccaggtggcatccttagctgggcct
ggagggcaagtggaaatagaacagaacttccttaacaacaaattgaagacaatcactgca
tattttggtgacctaattcgaagaccagcctctgaaacctaa

DBGET integrated database retrieval system