KEGG   Homo sapiens (human): 968Help
Entry
968               CDS       T01001                                 

Gene name
CD68, GP110, LAMP4, SCARD1
Definition
CD68 molecule
Orthology
K06501  
CD68 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    968 (CD68)
Cellular antigens [BR:hsa04090]
 Proteins
  968 (CD68)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 327 aa AA seqDB search
MRLAVLFSGALLGLLAESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHG
NVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSP
SPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSC
EGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDL
QAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSILLPLIIG
LILLGLLALVLIAFCIIRRRPSAYQAL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggctgtgcttttctcgggggccctgctggggctactggcagagagcactgga
acaaccagccacaggactaccaagagccacaaaaccaccactcacaggacaaccaccaca
ggcaccaccagccacggacccacgactgccactcacaaccccaccaccaccagccatgga
aacgtcacagttcatccaacaagcaatagcactgccaccagccagggaccctcaactgcc
actcacagtcctgccaccactagtcatggaaatgccacggttcatccaacaagcaacagc
actgccaccagcccaggattcaccagttctgcccacccagaaccacctccaccctctccg
agtcctagcccaacctccaaggagaccattggagactacacgtggaccaatggttcccag
ccctgtgtccacctccaagcccagattcagattcgagtcatgtacacaacccagggtgga
ggagaggcctggggcatctctgtactgaaccccaacaaaaccaaggtccagggaagctgt
gagggtgcccatccccacctgcttctctcattcccctatggacacctcagctttggattc
atgcaggacctccagcagaaggttgtctacctgagctacatggcggtggagtacaatgtg
tccttcccccacgcagcacagtggacattctcggctcagaatgcatcccttcgagatctc
caagcacccctggggcagagcttcagttgcagcaactcgagcatcattctttcaccagct
gtccacctcgacctgctctccctgaggctccaggctgctcagctgccccacacaggggtc
tttgggcaaagtttctcctgccccagtgaccggtccatcttgctgcctctcatcatcggc
ctgatccttcttggcctcctcgccctggtgcttattgctttctgcatcatccggagacgc
ccatccgcctaccaggccctctga

DBGET integrated database retrieval system