KEGG   Homo sapiens (human): 9682Help
Entry
9682              CDS       T01001                                 

Gene name
KDM4A, JHDM3A, JMJD2, JMJD2A, TDRD14A
Definition
(RefSeq) lysine demethylase 4A (EC:1.14.11.-)
  KO
K06709  
jumonji domain-containing protein 2 [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     9682 (KDM4A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    9682 (KDM4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 1064 aa AA seqDB search
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYD
DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
YWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELP
PRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDL
SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEE
QAAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTG
VLTVHSYAKGDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPL
SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNET
MAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI
NLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLCSL
RGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRT
AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSIT
AGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEG
EVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSV
ASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgagtctgaaactctgaatcccagtgctaggataatgaccttttatccaact
atggaagagttccgaaacttcagtagatacattgcctacattgaatcccaaggagctcat
cgggcagggctagccaaggttgttcctccaaaagagtggaagccacgagcatcctatgat
gacattgatgatttggtcattcctgcccccattcaacagctggtgacggggcagtctggc
ctctttactcagtacaacatacagaagaaagccatgactgttcgagagttccgcaagata
gccaatagcgataagtactgtaccccacgctatagtgagtttgaagagctcgagcggaaa
tactggaaaaatcttacattcaatcctccaatctatggtgcagatgtgaatggtaccctc
tatgaaaagcatgttgatgagtggaatattggccggctgagaacaatcctggacttggtg
gaaaaggagagtgggatcaccattgagggtgtgaacaccccatacctgtactttggcatg
tggaagacatcctttgcttggcacactgaagacatggacctctacagcatcaactacctg
cactttggagaaccaaagtcctggtactctgttccacctgagcatggaaagcggttggaa
cgcctcgccaaaggctttttcccaggaagtgctcaaagctgtgaggcatttctccgccac
aagatgaccctgatttccccgttaatgctgaagaaatatggaattccctttgacaaggtg
actcaagaggctggagagtttatgatcactttcccttatggttaccatgccggctttaac
catggttttaactgtgcggagtctaccaattttgctacccgtcggtggattgagtacggc
aagcaagctgtgctgtgctcctgtagaaaggacatggtgaagatctccatggatgtgttt
gtgagaaagttccagccagaaaggtacaaactttggaaagctgggaaggacaacacagtt
attgaccatactctgcccacgccagaagcagctgagtttcttaaggagagtgaactgcct
ccaagagctggcaacgaggaggagtgcccagaggaggacatggaaggggtggaggatgga
gaggaaggagacctgaagacaagcctggccaagcaccgaatagggacaaagaggcaccga
gtttgtcttgaaataccacaggaggtgagtcagagtgagctcttccccaaggaggatctg
agttctgagcagtatgagatgacggagtgcccggcagccctcgcccctgtgaggcccacc
catagctctgtgcggcaagttgaggatggtcttaccttcccagattattctgactccact
gaagtcaaatttgaagagcttaaaaatgtcaaactagaagaggaggatgaggaggaagaa
caagcagcagctgccttggatctttctgtgaatcctgcgtctgtagggggacgccttgtc
ttctcaggctccaaaaagaaatcatcttctagcctgggctctggctcttcacgggattct
atctcttctgattcagaaactagtgagcctctctcctgccgagcccaagggcaaacggga
gttctcactgtgcacagttatgccaaaggggatggcagggtcactgtgggagagccatgc
acgaggaagaaaggaagcgccgctagaagtttcagtgagcgggagctggcagaggttgca
gatgaatacatgttttccctagaagagaataagaagtccaagggacgccgtcagccttta
agcaagctcccccgccatcacccacttgtgctgcaggagtgtgtcagtgatgatgagaca
tctgaacagctgacccctgaggaagaggctgaggagacagaggcctgggccaagcctctg
agccaactgtggcagaaccgacctccaaactttgaggctgagaaggaattcaatgagacc
atggcccaacaggcccctcactgcgctgtctgtatgatcttccagacttatcatcaggtt
gaatttggaggctttaatcagaactgtggaaatgcttcagatttagccccccagaagcag
aggaccaagccattgattccagaaatgtgcttcacttcgactggctgcagcacggacatc
aacctttctactccttatcttgaggaggatggcaccagcatactcgtttcctgcaagaag
tgcagcgtccgggtccatgccagttgctatggggtcccccctgcaaaggcttctgaagac
tggatgtgttctcggtgttcagccaatgccctagaggaggactgctgtttatgctcatta
cgaggaggggccctgcagagagcaaatgatgacaggtgggtccacgtttcatgtgctgtg
gcaattctggaagcaaggtttgtcaacattgcagaaagaagtccggtggatgtgagcaaa
atccccctgccccgcttcaaactgaaatgtatcttctgtaagaagcggaggaaaagaact
gctggctgctgtgtgcagtgttctcacggccgctgcccaactgccttccatgtgagctgc
gcccaggctgccggtgtgatgatgcagcctgacgactggccttttgtggtcttcattacc
tgctttcggcacaagattcctaatttggagcgtgccaagggggccttgcaaagcatcact
gcaggccagaaagtcattagcaagcataagaacgggcgcttctaccagtgtgaagtggtc
aggctcaccaccgagaccttctatgaagtcaactttgatgatggctccttcagcgacaat
ctttatcctgaggacatagtgagccaggactgtctccagtttggtcctcctgctgaaggg
gaagtggtccaagtgagatggacagacggccaagtctatggagccaagtttgtggcctcc
caccctatccaaatgtaccaggtggagtttgaggatggctcacaacttgtggttaagaga
gatgatgtatacacactggatgaagagcttcccaagagagtcaaatctagactgtcagta
gcctcagacatgcgcttcaatgagattttcacagagaaagaggttaagcaagaaaagaaa
cggcaacgagttatcaactcaagataccgggaagattatattgagcctgcactataccgg
gccatcatggagtag

DBGET integrated database retrieval system