KEGG   Homo sapiens (human): 9688Help
Entry
9688              CDS       T01001                                 

Gene name
NUP93, NIC96
Definition
(RefSeq) nucleoporin 93kDa
  KO
K14309  
nuclear pore complex protein Nup93
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    9688 (NUP93)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9688 (NUP93)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q13
AA seq 819 aa AA seqDB search
MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKA
SVLLGSRGLDISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKR
TFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDN
IEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD
ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIK
LPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKD
RRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQ
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFE
STDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDK
FTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNK
ERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIED
RDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggatactgaggggtttggtgagctccttcagcaagctgaacagcttgctgctgagact
gagggcatctcagagcttccccatgtggaacggaacttacaggagatccagcaggcggga
gagcgcctgcgttcccgtaccctaacacgcacgtcccaggagacggcagatgtcaaggcg
tcagttctcctcgggtctcggggacttgacatatcccacatctcccagcgattggagagt
ctgagtgcagccaccacctttgagcctcttgagcctgtgaaggacactgacattcagggc
ttcctgaagaatgagaaggacaatgccctgctgtctgccatcgaagagtcccggaagagg
accttcggcatggctgaggagtaccatcgggagtcaatgttggttgagtgggagcaagtg
aaacagcgaattctgcacacactgctggcatcaggagaagacgcccttgactttactcaa
gaaagcgagccaagctacatcagtgatgtgggaccccctggtcgaagctctctggataac
atcgagatggcctatgcgcggcaaatttatatctataatgagaaaattgtaaatggacac
ctgcagcctaacctggtggacctttgtgcttccgtcgcagagctcgatgataagagcatt
tccgacatgtggaccatggtaaaacaaatgacagacgtgttgttgacaccggcaacggat
gccctgaagaaccgcagcagcgtggaagtgcgcatggagtttgtcaggcaggccttggcg
taccttgagcagagttataagaattacacccttgtgactgtctttggaaatttgcatcag
gcccagctgggcggggtgcctgggacttaccaattggttcgaagtttcctgaacattaaa
ctgccagctcccttgcctggactacaggatggagaggtggaaggccatcctgtgtgggcg
ctaatttactactgcatgcgctgtggagacctgcttgccgcttcacaggtagttaatcga
gcccagcaccagctgggagagtttaaaacctggttccaggagtacatgaacagcaaggac
agaagattgtccccagctacggaaaacaagctccggctgcattaccgtagggccctcagg
aacaatacagatccctacaagcgggccgtgtactgtatcattggcagatgtgacgtcacc
gacaaccagagtgaagtggcggacaaaactgaggattacctgtggctgaagttgaaccaa
gtgtgttttgacgacgatggcaccagctccccacaagacaggctcactctctcacagttc
cagaagcagttgttggaagactatggcgagtcccactttacggtgaaccagcaacccttc
ctctacttccaagtcctgttcctgacagcgcagtttgaagcagcagttgcctttcttttc
cgcatggagcggctgcgctgccatgctgtccatgtagcactggtgctgtttgagctgaag
ctgcttttaaagtcctctggacagagtgctcagctcctcagccacgagcctggtgaccct
ccttgcttgcggcggctgaacttcgtgcggctcctcatgctgtacacccggaagtttgag
tccacggacccaagggaggccctccagtacttctatttcctcagggatgagaaagatagt
caaggagaaaacatgtttctgcgctgtgtgagtgagcttgtgattgaaagccgagagttc
gatatgattcttgggaaactagagaatgacggaagtagaaagcctggagtcatagataag
tttactagtgacacaaagcctattatcaacaaagttgcttctgtggcagaaaataaagga
ctgtttgaagaggcagcaaagctgtatgaccttgccaagaatgctgacaaggtactggag
ctgatgaacaaactgctgagccctgtcgtcccccagatcagtgccccgcaatccaacaag
gagaggctgaagaacatggcactctccattgccgaacggtatagggctcaaggaataagc
gcaaataaatttgtggactccacgttctatcttcttttggacttgatcaccttttttgac
gagtatcatagtggtcatattgatagagcttttgatatcattgagcgcttgaagctggtg
cccctgaatcaggaaagtgtggaagagagagtggctgccttcagaaatttcagtgatgaa
atcaggcacaacctctcagaagtgcttcttgccaccatgaacatcttgttcacacagttt
aagaggctcaaggggacaagtccatcctcgtcatccaggccccagcgagtcatcgaggac
cgcgactctcaactccgaagtcaagcccgcactctgattacctttgctggaatgatacca
taccgaacgtctggggacaccaatgcgaggctggtgcagatggaggtcctcatgaattaa

DBGET integrated database retrieval system