KEGG   Homo sapiens (human): 9688Help
Entry
9688              CDS       T01001                                 

Gene name
NUP93, NIC96
Definition
nucleoporin 93kDa
Orthology
K14309  
nuclear pore complex protein Nup93
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q13
AA seq 696 aa AA seqDB search
MAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDNIEM
AYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATDALK
NRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIKLPA
PLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKDRRL
SPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQVCF
DDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLFRME
RLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTD
PREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTS
DTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNKERL
KNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLN
QESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDS
QLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagtaccatcgggagtcaatgttggttgagtgggagcaagtgaaacagcga
attctgcacacactgctggcatcaggagaagacgcccttgactttactcaagaaagcgag
ccaagctacatcagtgatgtgggaccccctggtcgaagctctctggataacatcgagatg
gcctatgcgcggcaaatttatatctataatgagaaaattgtaaatggacacctgcagcct
aacctggtggacctttgtgcttccgtcgcagagctcgatgataagagcatttccgacatg
tggaccatggtaaaacaaatgacagacgtgttgttgacaccggcaacggatgccctgaag
aaccgcagcagcgtggaagtgcgcatggagtttgtcaggcaggccttggcgtaccttgag
cagagttataagaattacacccttgtgactgtctttggaaatttgcatcaggcccagctg
ggcggggtgcctgggacttaccaattggttcgaagtttcctgaacattaaactgccagct
cccttgcctggactacaggatggagaggtggaaggccatcctgtgtgggcgctaatttac
tactgcatgcgctgtggagacctgcttgccgcttcacaggtagttaatcgagcccagcac
cagctgggagagtttaaaacctggttccaggagtacatgaacagcaaggacagaagattg
tccccagctacggaaaacaagctccggctgcattaccgtagggccctcaggaacaataca
gatccctacaagcgggccgtgtactgtatcattggcagatgtgacgtcaccgacaaccag
agtgaagtggcggacaaaactgaggattacctgtggctgaagttgaaccaagtgtgtttt
gacgacgatggcaccagctccccacaagacaggctcactctctcacagttccagaagcag
ttgttggaagactatggcgagtcccactttacggtgaaccagcaacccttcctctacttc
caagtcctgttcctgacagcgcagtttgaagcagcagttgcctttcttttccgcatggag
cggctgcgctgccatgctgtccatgtagcactggtgctgtttgagctgaagctgctttta
aagtcctctggacagagtgctcagctcctcagccacgagcctggtgaccctccttgcttg
cggcggctgaacttcgtgcggctcctcatgctgtacacccggaagtttgagtccacggac
ccaagggaggccctccagtacttctatttcctcagggatgagaaagatagtcaaggagaa
aacatgtttctgcgctgtgtgagtgagcttgtgattgaaagccgagagttcgatatgatt
cttgggaaactagagaatgacggaagtagaaagcctggagtcatagataagtttactagt
gacacaaagcctattatcaacaaagttgcttctgtggcagaaaataaaggactgtttgaa
gaggcagcaaagctgtatgaccttgccaagaatgctgacaaggtactggagctgatgaac
aaactgctgagccctgtcgtcccccagatcagtgccccgcaatccaacaaggagaggctg
aagaacatggcactctccattgccgaacggtatagggctcaaggaataagcgcaaataaa
tttgtggactccacgttctatcttcttttggacttgatcaccttttttgacgagtatcat
agtggtcatattgatagagcttttgatatcattgagcgcttgaagctggtgcccctgaat
caggaaagtgtggaagagagagtggctgccttcagaaatttcagtgatgaaatcaggcac
aacctctcagaagtgcttcttgccaccatgaacatcttgttcacacagtttaagaggctc
aaggggacaagtccatcctcgtcatccaggccccagcgagtcatcgaggaccgcgactct
caactccgaagtcaagcccgcactctgattacctttgctggaatgataccataccgaacg
tctggggacaccaatgcgaggctggtgcagatggaggtcctcatgaattaa

DBGET integrated database retrieval system