KEGG   Homo sapiens (human): 9695Help
Entry
9695              CDS       T01001                                 

Gene name
EDEM1, EDEM
Definition
(RefSeq) ER degradation enhancing alpha-mannosidase like protein 1
  KO
K10084  
ER degradation enhancer, mannosidase alpha-like 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9695 (EDEM1)
Lectins [BR:hsa04091]
 M-type lectins
  9695 (EDEM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92611(Tbio)
UniProt: 
Position
3p26.1
AA seq 657 aa AA seqDB search
MQWRALVLGLVLLRLGLHGVLWLVFGLGPSMGFYQRFPLSFGFQRLRSPDGPASPTSGPV
GRPGGVSGPSWLQPPGTGAAQSPRKAPRRPGPGMCGPANWGYVLGGRGRGPDEYEKRYSG
AFPPQLRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLG
NYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRI
ITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDTNNE
TCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVG
KQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLY
VNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQL
QAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDK
STEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFS
EEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcaatggcgagcgctcgtcctggggctggtgctcctccggcttggcctccatggagta
ttgtggctcgtcttcgggctggggcccagcatgggcttctaccagcgctttccgctcagc
ttcggcttccagcgtctgaggagccccgacggccccgcgtcgcccacctcggggcccgtg
ggccggcctgggggggtatccgggccgtcgtggctgcagccgccggggaccggggcagcg
cagagcccgcgcaaggctccgcggcgtcctgggccggggatgtgcggcccagccaactgg
ggctacgtgctgggcggccggggccgcggcccggacgagtacgagaagcgctacagcggc
gccttccctccgcagctgcgtgcccagatgcgcgacctggcacggggcatgttcgtcttt
ggctacgacaactacatggctcacgccttcccccaggacgagctcaaccccatccactgc
cgcggccgtgggcccgaccgcggggacccttcaaatctgaacatcaatgatgtactaggg
aactactcattgactcttgttgatgcattggatacacttgcaataatgggaaattcatcc
gagttccagaaagccgtcaagttagtgatcaacacagtttcatttgacaaagattccacc
gtccaagtctttgaggccacgataagggtcctgggaagcctcctttctgctcacagaata
ataactgactccaagcagccctttggtgacatgacaattaaggactatgataatgagttg
ttatacatggcccatgacctggcggtgcggctcctccctgcttttgaaaacaccaagaca
gggattccatatcctcgggtgaatctaaagacaggagttcctcctgacaccaataatgag
acatgcacagcgggagccggttccctcctggtggaatttgggattctgagtcgactcctg
ggggactccacatttgagtgggtggccagacgagcagtgaaagccctttggaacctccgg
agcaatgatacaggattactaggcaatgtcgtgaacattcagacgggccactgggttgga
aagcagagtggcctgggtgccgggctggactccttctatgaatacctcttgaaatcttac
attctctttggagaaaaagaagacctagaaatgtttaatgctgcatatcagagtattcag
aactacttaagaagagggcgggaagcctgcaatgaaggagaaggagaccctccactctat
gtcaacgtgaacatgttcagtgggcagctgatgaacacctggattgactctctgcaggcc
tttttccctggactgcaggtgctgataggagatgtggaagatgccatctgccttcatgcc
ttctactatgccatatggaaacgatatggtgccctccctgagagatataactggcagctg
caggcccctgacgttctcttctacccactgagaccagagttagtggaatccacatatctc
ctctaccaggcaaccaagaatcccttctacctccatgtaggaatggatattctgcagagt
ctggaaaagtacacaaaagtcaagtgtgggtacgccacgctgcatcacgtcattgacaag
tccacagaagaccggatggagagcttctttctcagtgagacctgtaaatatttgtatctg
ctgtttgatgaagacaatccagtacacaagtctggaaccagatacatgttcacaacagag
ggacacattgtatctgtggatgagcatcttcgggaattgccatggaaggaattcttctct
gaagagggagggcaggaccaagggggaaagtctgtgcacaggccgaaacctcatgagtta
aaagtcatcaactccagctccaactgcaatcgtgtacctgatgagaggaggtactccctg
cccttaaagagcatctacatgcgacagattgaccagatggttggtttgatttga

DBGET integrated database retrieval system