KEGG   Homo sapiens (human): 970Help
Entry
970               CDS       T01001                                 

Gene name
CD70, CD27L, CD27LG, TNFSF7
Definition
CD70 molecule
Orthology
K05470  
tumor necrosis factor ligand superfamily member 7
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    970 (CD70)
Cellular antigens [BR:hsa04090]
 Proteins
  970 (CD70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13
AA seq 193 aa AA seqDB search
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAEL
QLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTA
SRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRN
TDETFFGVQWVRP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggagggttcgggctgctcggtgcggcgcaggccctatgggtgcgtcctgcgg
gctgctttggtcccattggtcgcgggcttggtgatctgcctcgtggtgtgcatccagcgc
ttcgcacaggctcagcagcagctgccgctcgagtcacttgggtgggacgtagctgagctg
cagctgaatcacacaggacctcagcaggaccccaggctatactggcaggggggcccagca
ctgggccgctccttcctgcatggaccagagctggacaaggggcagctacgtatccatcgt
gatggcatctacatggtacacatccaggtgacgctggccatctgctcctccacgacggcc
tccaggcaccaccccaccaccctggccgtgggaatctgctctcccgcctcccgtagcatc
agcctgctgcgtctcagcttccaccaaggttgtaccattgcctcccagcgcctgacgccc
ctggcccgaggggacacactctgcaccaacctcactgggacacttttgccttcccgaaac
actgatgagaccttctttggagtgcagtgggtgcgcccctga

DBGET integrated database retrieval system