KEGG   Homo sapiens (human): 9700Help
Entry
9700              CDS       T01001                                 

Gene name
ESPL1, ESP1, SEPA
Definition
extra spindle pole bodies homolog 1 (S. cerevisiae) (EC:3.4.22.49)
Orthology
K02365  
separase [EC:3.4.22.49]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9700 (ESPL1)
   04114 Oocyte meiosis
    9700 (ESPL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     9700 (ESPL1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C50: separase family
   9700 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q
AA seq 2120 aa AA seqDB search
MRSFKRVNFGTLLSSQKEAEELLPALKEFLSNPPAGFPSSRSDAERRQACDAILRACNQQ
LTAKLACPRHLGSLLELAELACDGYLVSTPQRPPLYLERILFVLLRNAAAQGSPEATLRL
AQPLHACLVQCSREAAPQDYEAVARGSFSLLWKGAEALLERRAAFAARLKALSFLVLLED
ESTPCEVPHFASPTACRAVAAHQLFDASGHGLNEADADFLDDLLSRHVIRALVGERGSSS
GLLSPQRALCLLELTLEHCRRFCWSRHHDKAISAVEKAHSYLRNTNLAPSLQLCQLGVKL
LQVGEEGPQAVAKLLIKASAVLSKSMEAPSPPLRALYESCQFFLSGLERGTKRRYRLDAI
LSLFAFLGGYCSLLQQLRDDGVYGGSSKQQQSFLQMYFQGLHLYTVVVYDFAQGCQIVDL
ADLTQLVDSCKSTVVWMLEALEGLSGQELTDHMGMTASYTSNLAYSFYSHKLYAEACAIS
EPLCQHLGLVKPGTYPEVPPEKLHRCFRLQVESLKKLGKQAQGCKMVILWLAALQPCSPE
HMAEPVTFWVRVKMDAARAGDKELQLKTLRDSLSGWDPETLALLLREELQAYKAVRADTG
QERFNIICDLLELSPEETPAGAWARATHLVELAQVLCYHDFTQQTNCSALDAIREALQLL
DSVRPEAQARDQLLDDKAQALLWLYICTLEAKMQEGIERDRRAQAPGNLEEFEVNDLNYE
DKLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKELLTKGQAPAVRCLQQTAASLQILA
ALYQLVAKPMQALEVLLLLRIVSERLKDHSKAAGSSCHITQLLLTLGCPSYAQLHLEEAA
SSLKHLDQTTDTYLLLSLTCDLLRSQLYWTHQKVTKGVSLLLSVLRDPALQKSSKAWYLL
RVQVLQLVAAYLSLPSNNLSHSLWEQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDILS
TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTK
LQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQ
KGKQQAQVPCPPQLPEEELFLRGPALELVATVAKEPGPIAPSTNSSPVLKTKPQPIPNFL
SHSPTCDCSLCASPVLTAVCLRWVLVTAGVRLAMGHQAQGLDLLQVVLKGCPEAAERLTQ
ALQASLNHKTPPSLVPSLLDEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPH
LEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGR
QKLASAPLRLNNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQA
PRVQQRVQTRLKVNFSDDSDLEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVV
APGSAPGNPGLNGRSRRAKKVASRHCEERRPQRASDQARPGPEIMRTIPEEELTDNWRKM
SFEILRGSDGEDSASGGKTPAPGPEAASGEWELLRLDSSKKKLPSPCPDKESDKDLGPRL
RLPSAPVATGLSTLDSICDSLSVAFRGISHCPPSGLYAHLCRFLALCLGHRDPYATAFLV
TESVSITCRHQLLTHLHRQLSKAQKHRGSLEIADQLQGLSLQEMPGDVPLARIQRLFSFR
ALESGHFPQPEKESFQERLALIPSGVTVCVLALATLQPGTVGNTLLLTRLEKDSPPVSVQ
IPTGQNKLHLRSVLNEFDAIQKAQKENSSCTDKREWWTGRLALDHRMEVLIASLEKSVLG
CWKGLLLPSSEEPGPAQEASRLQELLQDCGWKYPDRTLLKIMLSGAGALTPQDIQALAYG
LCPTQPERAQELLNEAVGRLQGLTVPSNSHLVLVLDKDLQKLPWESMPSLQALPVTRLPS
FRFLLSYSIIKEYGASPVLSQGVDPRSTFYVLNPHNNLSSTEEQFRANFSSEAGWRGVVG
EVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVRGNL
EGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVNQARQAP
RLKYLIGAAPIAYGLPVSLR
NT seq 6363 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcttcaaaagagtcaactttgggactctgctaagcagccagaaggaggctgaa
gagttgctgcccgccttgaaggagttcctgtccaaccctccagctggttttcccagcagc
cgatctgatgctgagaggagacaagcttgtgatgccatcctgagggcttgcaaccagcag
ctgactgctaagctagcttgccctaggcatctggggagcctgctggagctggcagagctg
gcctgtgatggctacttagtgtctaccccacagcgtcctcccctctacctggaacgaatt
ctctttgtcttactgcggaatgctgctgcacaaggaagcccagaggccacactccgcctt
gctcagcccctccatgcctgcttggtgcagtgctctcgcgaggctgctccccaggactat
gaggccgtggctcggggcagcttttctctgctttggaagggggcagaagccctgttggaa
cggcgagctgcatttgcagctcggctgaaggccttgagcttcctagtactcttggaggat
gaaagtaccccttgtgaggttcctcactttgcttctccaacagcctgtcgagcggtagct
gcccatcagctatttgatgccagtggccatggtctaaatgaagcagatgctgatttccta
gatgacctgctctccaggcacgtgatcagagccttggtgggtgagagagggagctcttct
gggcttctttctccccagagggccctctgcctcttggagctcaccttggaacactgccgt
cgcttttgctggagccgccaccatgacaaagccatcagcgcagtggagaaggctcacagt
tacctaaggaacaccaatctagcccctagccttcagctatgtcagctgggggttaagctg
ctgcaggttggggaggaaggacctcaggcagtggccaagcttctgatcaaggcatcagct
gtcctgagcaagagtatggaggcaccatcacccccacttcgggcattgtatgagagctgc
cagttcttcctttcaggcctggaacgaggcaccaagaggcgctatagacttgatgccatt
ctgagcctctttgcttttcttggagggtactgctctcttctgcagcagctgcgggatgat
ggtgtgtatgggggctcctccaagcaacagcagtcttttcttcagatgtactttcaggga
cttcacctctacactgtggtggtttatgactttgcccaaggctgtcagatagttgatttg
gctgacctgacccaactagtggacagttgtaaatctaccgttgtctggatgctggaggcc
ttagagggcctgtcgggccaagagctgacggaccacatggggatgaccgcttcttacacc
agtaatttggcctacagcttctatagtcacaagctctatgccgaggcctgtgccatctct
gagccgctctgtcagcacctgggtttggtgaagccaggcacttatcccgaggtgcctcct
gagaagttgcacaggtgcttccggctacaagtagagagtttgaagaaactgggtaaacag
gcccagggctgcaagatggtgattttgtggctggcagccctgcaaccctgtagccctgaa
cacatggctgagccagtcactttctgggttcgggtcaagatggatgcggccagggctgga
gacaaggagctacagctaaagactctgcgagacagcctcagtggctgggacccggagacc
ctggccctcctgctgagggaggagctgcaggcctacaaggcggtgcgggccgacactgga
caggaacgcttcaacatcatctgtgacctcctggagctgagccccgaggagacaccagcc
ggggcctgggcacgagccacccacctggtagaactggctcaggtgctctgctaccacgac
tttacgcagcagaccaactgctctgctctggatgctatccgggaagccctgcagcttctg
gactctgtgaggcctgaggcccaggccagagatcagcttctggacgataaagcacaggcc
ttgctgtggctttacatctgtactctggaagccaaaatgcaggaaggtatcgagcgggat
cggagagcccaggcccctggtaacttggaggaatttgaagtcaatgacctgaactatgaa
gataaactccaggaagatcgtttcctatacagtaacattgccttcaacctggctgcagat
gctgctcagtccaaatgcctggaccaagccctggccctgtggaaggagctgcttacaaag
gggcaggccccagctgtacggtgtctccagcagacagcagcctcactgcagatcctagca
gccctctaccagctggtggcaaagcccatgcaggctctggaggtcctcctgctgctacgg
attgtctctgagagactgaaggaccactcgaaggcagctggctcctcctgccacatcacc
cagctcctcctgaccctcggctgtcccagctatgcccagttacacctggaagaggcagca
tcgagcctgaagcatctcgatcagactactgacacatacctgctcctttccctgacctgt
gatctgcttcgaagtcaactctactggactcaccagaaggtgaccaagggtgtctctctg
ctgctgtctgtgcttcgggatcctgccctccagaagtcctccaaggcttggtacttgctg
cgtgtccaggtcctgcagctggtggcagcttaccttagcctcccgtcaaacaacctctca
cactccctgtgggagcagctctgtgcccaaggctggcagacacctgagatagctctcata
gactcccataagctcctccgaagcatcatcctcctgctgatgggcagtgacattctctca
actcagaaagcagctgtggagacatcgtttttggactatggtgaaaatctggtacaaaaa
tggcaggttctttcagaggtgctgagctgctcagagaagctggtctgccacctgggccgc
ctgggtagtgtgagtgaagccaaggccttttgcttggaggccctaaaacttacaacaaag
ctgcagataccacgccagtgtgccctgttcctggtgctgaagggcgagctggagctggcc
cgcaatgacattgatctctgtcagtcggacctgcagcaggttctgttcttgcttgagtct
tgcacagagtttggtggggtgactcagcacctggactctgtgaagaaggtccacctgcag
aaggggaagcagcaggcccaggtcccctgtcctccacagctcccagaggaggagctcttc
ctaagaggccctgctctagagctggtggccactgtggccaaggagcctggccccatagca
ccttctacaaactcctccccagtcttgaaaaccaagccccagcccatacccaacttcctg
tcccattcacccacctgtgactgctcgctctgcgccagccctgtcctcacagcagtctgt
ctgcgctgggtattggtcacggcaggggtgaggctggccatgggccaccaagcccagggt
ctggatctgctgcaggtcgtgctgaagggctgtcctgaagccgctgagcgcctcacccaa
gctctccaagcttccctgaatcataaaacacccccctccttggttccaagcctcttggat
gagatcttggctcaagcatacacactgttggcactggagggcctgaaccagccatcaaac
gagagcctgcagaaggttctacagtcagggctgaagtttgtagcagcacggataccccac
ctagagccctggcgagccagcctgctcttgatttgggccctcacaaaactaggtggcctc
agctgctgtactacccaactttttgcaagctcctggggctggcagccaccattaataaaa
agtgtccctggctcagagccctctaagactcagggccaaaaacgttctggacgagggcgc
caaaagttagcctctgctcccctgcgcctcaataatacctctcagaaaggtctggaaggt
agaggactgccctgcacacctaaacccccagaccggatcaggcaagctggccctcatgtc
cccttcacggtgtttgaggaagtctgccctacagagagcaagcctgaagtaccccaggcc
cccagggtacaacagagagtccagacgcgcctcaaggtgaacttcagtgatgacagtgac
ttggaagaccctgtctcagctgaggcctggctggcagaggagcctaagagacggggcact
gcttcccggggccgggggcgagcaaggaagggcctgagcctaaagacggatgccgtggtt
gccccaggtagtgcccctgggaaccctggcctgaatggcaggagccggagggccaagaag
gtggcatcaagacattgtgaggagcggcgtccccagagggccagtgaccaggccaggcct
ggccctgagatcatgaggaccatccctgaggaagaactgactgacaactggagaaaaatg
agctttgagatcctcaggggctctgacggggaagactcagcctcaggtgggaagactcca
gctccgggccctgaggcagcttctggagaatgggagctgctgaggctggattccagcaag
aagaagctgcccagcccatgcccagacaaggagagtgacaaggaccttggtcctcggctc
cggctcccctcagcccccgtagccactggtctttctaccctggactccatctgtgactcc
ctgagtgttgctttccggggcattagtcactgtcctcctagtgggctctatgcccacctc
tgccgcttcctggccttgtgcctgggccaccgggatccttatgccactgctttccttgtc
accgagtctgtctccatcacctgtcgccaccagctgctcacccacctccacagacagctc
agcaaggcccagaagcaccgaggatcacttgaaatagcagaccagctgcaggggctgagc
cttcaggagatgcctggagatgtccccctggcccgcatccagcgcctcttttccttcagg
gctttggaatctggccacttcccccagcctgaaaaggagagtttccaggagcgcctggct
ctgatccccagtggggtgactgtgtgtgtgttggccctggccaccctccagcccggaacc
gtgggcaacaccctcctgctgacccggctggaaaaggacagtcccccagtcagtgtgcag
attcccactggccagaacaagcttcatctgcgttcagtcctgaatgagtttgatgccatc
cagaaggcacagaaagagaacagcagctgtactgacaagcgagaatggtggacagggcgg
ctggcactggaccacaggatggaggttctcatcgcttccctagagaagtctgtgctgggc
tgctggaaggggctgctgctgccgtccagtgaggagcccggccctgcccaggaggcctcc
cgcctacaggagctgctacaggactgtggctggaaatatcctgaccgcactctgctgaaa
atcatgctcagtggtgccggtgccctcacccctcaggacattcaggccctggcctacggg
ctgtgcccaacccagccagagcgagcccaggagctcctgaatgaggcagtaggacgtcta
cagggcctgacagtaccaagcaatagccaccttgtcttggtcctagacaaggacttgcag
aagctgccgtgggaaagcatgcccagcctccaagcactgcctgtcacccggctgccctcc
ttccgcttcctactcagctactccatcatcaaagagtatggggcctcgccagtgctgagt
caaggggtggatccacgaagtaccttctatgtcctgaaccctcacaataacctgtcaagc
acagaggagcaatttcgagccaatttcagcagtgaagctggctggagaggagtggttggg
gaggtgccaagacctgaacaggtgcaggaagccctgacaaagcatgatttgtatatctat
gcagggcatggggctggtgcccgcttccttgatgggcaggctgtcctgcggctgagctgt
cgggcagtggccctgctgtttggctgtagcagtgcggccctggctgtgcgtggaaacctg
gagggggctggcatcgtgctcaagtacatcatggctggttgccccttgtttctgggtaat
ctctgggatgtgactgaccgcgacattgaccgctacacggaagctctgctgcaaggctgg
cttggagcaggcccaggggccccccttctctactatgtaaaccaggcccgccaagctccc
cgactcaagtatcttattggggctgcacctatagcctatggcttgcctgtctctctgcgg
taa

DBGET integrated database retrieval system