KEGG   Homo sapiens (human): 9706Help
Entry
9706              CDS       T01001                                 

Gene name
ULK2, ATG1B, Unc51.2
Definition
unc-51 like autophagy activating kinase 2 (EC:2.7.11.1)
Orthology
K08269  
serine/threonine-protein kinase ULK/ATG1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 1036 aa AA seqDB search
MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKIL
KELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMR
ILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMY
MAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRET
SPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQGPVKKSCPVPVPMYSGSVSGSSCGSSP
SCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASTSSKNSSCDTDDFVLVPHNI
SSDHSCDMPVGTAGRRASNEFLVCGGQCQPTVSPHSETAPIPVPTQIRNYQRIEQNLTST
ASSGTNVHGSPRSAVVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLSTGSSRPYSPSPL
VGTIPEQFSQCCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNKQ
KLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTSPTKHLGSSPRSSDWFFKTPLPTIIGS
PTKTTAPFKIPKTQASSNLLALVTRHGPAEEQSKDGNEPRECAHCLLVQGSERQRAEQQS
KAVFGRSVSTGKLSDQQGKTPICRHQGSTDSLNTERPMDIAPAGACGGVLAPPAGTAASS
KAVLFTVGSPPHSAAAPTCTHMFLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSS
PPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECV
LDLTAMRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLH
LAKAQIKSGKLSPSTAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVT
AEKLIYNCAVEMVQSAALDEMFQQTEDIVYRYHKAALLLEGLSRILQDPADIENVHKYKC
SIERRLSALCHSTATV
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtgggtgacttcgagtacagcaagagggatctcgtgggacacggggccttc
gccgtggtcttccgggggcggcaccgccagaaaactgattgggaggtagctattaaaagt
attaataaaaagaacttgtcaaaatcacaaatactgcttggaaaggaaattaaaatctta
aaggaacttcagcatgaaaatattgtagcactctatgatgttcaggaattacccaactct
gtctttttggtgatggagtattgcaatggtggagacctcgcagattatttgcaagcgaaa
gggactctcagtgaagacacgatcagagtgtttctgcatcagattgctgctgccatgcga
atcctgcacagcaaaggaatcatccacagagatctcaaaccacagaacatcttgctgtcc
tatgccaatcgcagaaaatcaagtgtcagtggtattcgcatcaaaatagcggattttggt
tttgctcgttacctacatagtaacatgatggctgcaacactgtgtggatccccgatgtac
atggctcctgaggttattatgtctcaacattatgatgctaaggctgacttgtggagcata
ggaacagtgatataccaatgcctagttggaaaaccaccttttcaggccaatagtcctcaa
gacttaaggatgttttatgaaaaaaacaggagcttaatgcctagtattcccagagaaaca
tcaccttatttggctaatctccttttgggtttgcttcagagaaaccaaaaagatagaatg
gactttgaagcattttttagccatccttttcttgagcaaggtccagtaaaaaaatcttgc
ccagttccagtgcccatgtattctggttctgtctctggaagctcctgtggcagctctcca
tcttgtcgttttgcttctccaccatcccttccagatatgcagcatattcaggaagaaaac
ttatcttccccaccattgggtcctcccaactatctacaagtttccaaagattctgccagt
actagtagcaagaactcttcttgtgacacggatgactttgttttggtgccacacaacatc
tcgtcagaccactcatgtgatatgccagtggggactgctggcagacgtgcttcaaatgaa
ttcttggtgtgtggagggcagtgtcagcctactgtgtcacctcacagcgaaacagcacca
attccagttcctactcaaataaggaattatcagcgcatagagcagaatcttacatctact
gccagctcaggcacaaatgtacatggttctccaagatctgcagtggtacgaaggtccaac
accagccccatgggcttcctccggccgggatcatgctccccagtaccagcagacacagca
cagacagttggacgaaggctctccactgggtcttctaggccttactcaccttcccctttg
gttggtaccattcctgagcaattcagtcagtgctgctgtgggcatcctcagggccatgac
tccaggagtagaaactcctcaggttctccagtgccacaagctcagtccccacagtctctc
ttatcgggtgctagactgcagagcgcccccaccctcactgacatctatcagaacaagcag
aagctcagaaaacagcactctgaccccgtgtgcccatcccatactggggctgggtacagc
tactcgcctcagcccagtcggcctggcagccttggaacttctcccaccaagcacttgggg
tcctctccacggagttctgactggttctttaaaactcctttgccaacaatcattggctct
cctactaagaccacagctcctttcaaaatccctaaaactcaagcatcttccaacctgtta
gccttggttactcgtcatgggcctgctgaagaacagtcgaaagatgggaatgagccacgg
gaatgtgcccattgcctcttagtgcaaggaagtgagaggcagcgggccgagcagcagagc
aaggcagtgtttggcagatctgtcagtaccgggaagttatcagatcaacaaggaaagact
cctatatgtcgacatcagggcagcacagacagtttaaatacagaacgaccaatggatata
gctccggcaggagcctgtggtggtgttctggcacctcctgcaggtacagcagcaagttcc
aaggctgtcctcttcactgtagggtctcctccacacagtgcggcagcccccacttgtacc
cacatgttccttcgaacaagaacaacctcagtggggcccagcaactccgggggctctctt
tgtgccatgagtggccgcgtgtgcgtggggtccccgcctggcccaggcttcggctcttcc
cctccaggagcagaggcagctcccagcctgagatacgtgccttacggtgcttcacccccc
agcctagaggggctcatcacctttgaagcccctgaactgccggaggagacgctgatggag
cgggaacacacagacaccttacgccatctgaatgtgatgctgatgttcactgagtgtgtg
ctggacctgacagccatgaggggaggaaaccctgagctgtgcacatctgctgtgtccttg
taccagatccaggagagtgtggtggtggaccagatcagtcagctgagcaaagactggggg
cgggtggagcagctggtgttgtacatgaaagcagcacagctgcttgcggcttctctgcat
cttgccaaagcccagatcaagtccgggaaactgagcccatccacagctgtgaaacaagtt
gtcaagaatctgaacgaacgatataaattctgcatcaccatgtgcaagaaacttacagaa
aagctgaatcgattcttctctgacaaacagaggtttattgatgaaatcaacagtgtgact
gcagagaaactcatctataattgtgctgtagaaatggttcagtctgcagccctggatgag
atgtttcagcagaccgaagatattgtttatcgctatcataaggcagcccttcttttggaa
ggcctaagtaggattctacaggaccctgcagatattgaaaatgtgcataaatataaatgt
agtattgagagaagactgtcggcgctctgccatagcaccgcaaccgtgtga

DBGET integrated database retrieval system