KEGG   Homo sapiens (human): 9708Help
Entry
9708              CDS       T01001                                 

Gene name
PCDHGA8, PCDH-GAMMA-A8
Definition
(RefSeq) protocadherin gamma subfamily A, 8
  KO
K16495  
protocadherin gamma subfamily A
Organism
hsa  Homo sapiens (human)
Brite
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Clustered protocadherin
   PCDHGA; protocadherin gamma subfamily A [KO:K16495]
    9708 (PCDHGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31
AA seq 932 aa AA seqDB search
MAAPQSRPRRGELILLCALLGTLWEIGRGQIRYSVPEETDKGSFVGNISKDLGLDPRKLA
KHGVRIVSRGRTQLFALNPRSGSLITAGRIDREELCAQSPRCLININTLVEDKGKLFGVE
IEIIDINDNNPKFQVEDLEVKINEIAVPGARYPLPEAVDPDVGVNSLQSYQLSPNHHFSL
DVQTGDNGAINPELVLERALDREEEAAHHLVLTASDGGKPPRSSTVRIHVTVLDTNDNAP
VFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKFRKINEKQTPLFQLNENTGE
ISIAKSLDYEECSFYEMEIQAEDVGALLGRTKLLISVEDVNDNRPEVIITSLFSPVLENS
LPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNI
TVMASDLGTPPLSTETQIALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPD
SQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQSFDYEQIRDLQLLVTASDSGDP
PLSSNMSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPEVLTELGSLKPSVDPNDSSLTLYLVVAVAAISCVFLAFVAVLLGLRLRRWH
KSRLLQDSGGRLVGVPASHFVGVEEVQAFLQTYSQEVSLTADSRKSHLIFPQPNYADMLI
SQEGCEKNDSLLTSVDFHEYKNEADHGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggccgctccacagagtcgccccagacgcggcgagctgatcctgctgtgcgcgctgctg
ggaacgctgtgggaaatcgggaggggacagattcgctactctgtgccagaagagacggac
aaaggctccttcgtgggtaatatctccaaggacctggggctggacccccggaagctggcg
aagcacggagtccgtatcgtctccagaggtaggacgcagctctttgctctgaacccgcgc
agcggcagcttgatcaccgcgggcaggatagatcgggaggagctctgcgctcagagcccg
cggtgtctgataaatattaacaccctggttgaggataaaggaaaactctttggggtagaa
atagaaataattgatattaacgataataacccaaaattccaggtcgaagatctagaagta
aaaattaacgaaatcgcggttcctggagcacgttatccactcccagaagctgttgacccg
gatgtgggcgtgaactccctccagagctaccagctcagccccaatcaccacttctccctg
gacgtgcagactggagacaatggagccataaacccagagctggtgctggagcgcgccctg
gacagggaggaagaggctgctcaccacctggtcctcacggcctcggatggcggcaagccg
cctcgctctagcacagtgcgcatccacgtgacagtgttggatacaaatgacaatgccccg
gtttttcctcacccgatttaccgagtgaaagtccttgagaacatgcccccaggcacgcgg
ctgcttactgtaacagccagcgacccggatgagggaatcaacggaaaagtggcatacaaa
ttccggaaaattaatgaaaaacaaactccgttattccagcttaatgaaaatactggggaa
atatcaatagcaaaaagtctagattatgaagaatgttcattttatgaaatggaaatacaa
gccgaagatgtgggggcacttctggggaggaccaaattgctcatttcggtggaagatgta
aatgacaatagaccagaagtgatcattacgtctttgtttagcccagtgttagaaaattct
cttcccgggacagtaattgccttcttgagtgtgcatgaccaagactctggaaagaatggt
caagttgtctgttacacacgtgataatttaccttttaaattagaaaagtcaataggtaat
tattatagattagtgacaaggaaatatttggaccgagaaaatgtctctatctacaatatc
acagtgatggcctcagatctaggaacaccacctctgtccactgaaactcaaatcgctctg
cacgtggcagacattaacgacaaccctcctactttccctcatgcctcctactcagcgtat
atcctagagaacaacctgagaggagcctccatcttttccttgactgcacacgaccccgac
agccaggagaatgcccaggtcacttactctgtgaccgaggacacgctgcagggggcgccc
ctgtcctcgtatatctccatcaactctgacaccggtgtcctgtatgcgctgcaatctttc
gactatgagcagatccgagacctgcagctactggtaacagccagcgacagcggggacccg
cccctcagcagcaacatgtcactgagcctgttcgtgctggaccagaatgacaacgcgccc
gagatcctgtaccccgccctccccacagacggttccactggcgtggagctggcgccccgc
tccgcagagcgtggctacctggtgaccaaggtggtggcggtggacagagactcgggccag
aacgcctggctgtcctaccgcctgctcaaggccagcgagccgggactcttctcggtgggt
ctgcacacgggcgaggtgcgcacggcgcgagccctgctggacagagatgcgctcaagcag
agcctcgtggtggccgtccaggaccatggccagccccctctctccgccactgtcacgctc
accgtagccgtggctgacagcatccccgaagtcctgaccgagttgggcagtctgaagcct
tcggtcgacccgaacgattcgagccttacactctatctcgtggtggcagtggctgccatc
tcctgtgtcttcctcgcctttgtcgctgtgcttctggggctcaggctgaggcgctggcac
aagtcacgcctgctccaggattccggtggcagattggtaggcgtgcctgcctcacatttt
gtgggtgttgaggaggtacaggctttcctgcagacctattcccaggaagtctccctcacc
gccgactcgcggaagagtcacctgatctttccccagcccaactacgcagacatgctcatc
agtcaggagggctgtgagaaaaatgattctttgttaacatccgtagattttcatgaatat
aagaatgaagctgatcatggtcagcaagccccgcccaacacggactggcgtttctctcag
gcccagagacccggcaccagcggctcccaaaatggcgatgacaccggcacctggcccaac
aaccagtttgacacagagatgctgcaagccatgatcttggcgtccgccagtgaagctgct
gatgggagctccaccctgggagggggtgccggcaccatgggattgagcgcccgctacgga
ccccagttcaccctgcagcacgtgcccgactaccgccagaatgtctacatcccaggcagc
aatgccacactgaccaacgcagctggcaagcgggatggcaaggccccagcaggtggcaat
ggcaacaagaagaagtcgggcaagaaggagaagaagtaa

DBGET integrated database retrieval system