KEGG   Homo sapiens (human): 9716Help
Entry
9716              CDS       T01001                                 

Gene name
AQR, IBP160, fSAP164
Definition
aquarius intron-binding spliceosomal factor
Orthology
K12874  
intron-binding protein aquarius
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q14
AA seq 1485 aa AA seqDB search
MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFA
IRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFP
FFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQL
ARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSE
PVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQ
LLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVD
TRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELLVSRHERRISQIQQ
LNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVT
INLNVRDHIKDEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGM
LDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRK
PKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLS
IEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVE
PHVIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNI
YHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNY
VLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPD
VTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSG
LDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQN
PQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRAR
ASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQN
LGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTV
DRFQGQQNDYILLSLVRTRAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAF
SQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQMANFVYNMYMHLIQTTHHYH
QTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPS
ETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK
NT seq 4458 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccctgcgcagcccaagaagatcgtggcccctacggtgtcccaaatcaatgcg
gagttcgtgacccagttagcatgtaaatactgggctccccacatcaagaagaaatcacct
tttgatataaaggttattgaagatatatatgaaaaagagattgtcaaatcaaggtttgct
attagaaagataatgctcttggaatttagccagtatcttgaaaattatctctggatgaat
tattctcctgaggtatctagcaaggcctatttaatgtcaatctgctgtatggtgaatgag
aagtttagagaaaacgtgcctgcatgggagatttttaagaagaagccagaccacttccca
ttcttttttaaacacatcttgaaggcggcattagctgaaactgatggtgaattttcactt
catgaacagacagtcttactactttttcttgatcattgcttcaatagtttggaagtagac
ttgatacgaagtcaagtacagcagcttatctccctcccaatgtggatgggcttacagctg
gcacgattggaattagaattaaaaaagacacctaagctaagaaaattctggaacttgatt
aaaaagaatgatgaaaagatggatccagaagcaagagaacaggcatatcaagagaggaga
tttctttcacaactcatccagaagtttatctctgtgctgaaatcagtcccactttctgaa
cctgtcactatggacaaagttcattactgtgaaagattcattgaacttatgattgatcta
gaggccctgctacccacaaggcgctggtttaataccatcctggatgattcccaccttctg
gttcactgttacctttccaatcttgttcgtagagaagaggatggccatcttttttcccag
cttttggacatgcttaaattctatactggttttgaaattaatgaccaaactggaaatgct
ctgacagagaatgagatgaccacaattcactatgatagaattacttctctacagagagct
gcttttgcacattttcctgaactctatgattttgccctctcaaatgtggcagaagtagat
actcgggagtccttggtcaagttttttggacctcttagttcaaacacactccaccaggtg
gcatcatacctctgcttgttgccaactcttcctaaaaatgaagacacaacttttgataaa
gaatttcttctagaattgctggtatctcgtcatgaacgtcgaatttctcagattcagcag
ttgaaccagatgcctttgtatccaactgagaaaattatatgggatgaaaatattgtccca
actgagtactattctggagaaggttgtcttgctcttcccaaattgaatttgcagtttttg
actcttcatgactacctgctaaggaactttaacctcttccgcttagaatcaacttatgaa
attcgtcaggacattgaagatagtgtcagcagaatgaagccatggcaatctgaatatggc
ggtgtagtgtttggtggttgggcgcgaatggcccagcccattgtggctttcactgtcgtt
gaagtggccaaacccaacataggtgaaaactggccaacccgagttcgtgcagatgttacc
ataaatctcaatgtcagagatcacatcaaagatgaatgggaaggtcttcgtaagcatgat
gtatgctttttaattaccgtacgtcccacaaaaccttatggcactaagtttgaccggagg
agaccttttattgagcaggttggcctggtttatgtcagaggctgtgaaattcagggcatg
ctggatgataaaggacgtgtcattgaagatggacctgaacccagacccaatcttagagga
gaatcaaggacatttagagtgtttttggatccaaaccagtatcaacaagatatgaccaat
actatacaaaatggagcagaggatgtgtatgaaacttttaatataataatgaggagaaaa
ccaaaggaaaataactttaaggctgtgctggagactattcggaacctgatgaatactgat
tgtgtggtacctgactggctgcacgatatcattttaggttatggggacccaagtagtgca
cattattcgaaaatgcccaatcagattgccacccttgatttcaatgatacatttctctcc
attgagcatttaaaagccagcttccctggtcataatgttaaagtaactgtagaagaccct
gctctacaaataccccctttcaggataacttttccagtaagaagtggaaaagggaagaaa
aggaaagatgcggatgtggaagatgaagacaccgaggaagcaaaaaccttaattgttgag
ccccatgttattcctaataggggtccttatccttataatcaacccaaacgtaatacgatt
cagttcactcatacacagatagaagccatccgtgctggaatgcagcctgggctgactatg
gttgtgggcccacctggtacaggcaaaacagatgtggcagttcagatcatatccaacatc
taccacaacttcccagaacagaggactctaattgttactcattccaatcaggccctaaac
cagttgtttgagaaaatcatggcattagacattgatgagcgccacctactgcgtcttggt
catggagaagaagagctggagacagagaaagatttcagcaggtatggaagagttaattat
gttctggctcgaagaatagaacttttagaagaagtcaaacgattgcaaaagagtctaggg
gttccaggagatgcctcatatacctgtgaaactgcaggctatttcttcttataccaggta
atgtctcgctgggaagagtatatcagcaaagtgaaaaataaaggtagtacattgccagat
gttacggaagtctccactttcttccctttccatgaatactttgcaaatgctcctcaaccc
atttttaaaggaagatcttatgaagaagacatggaaattgctgaaggatgtttcaggcat
attaagaaaatctttacgcagcttgaggaattcagagcctctgaattgcttcgaagtgga
ctggacagatctaaataccttttagtgaaagaagccaaaattattgctatgacctgtact
catgctgccttaaaacgacatgacttggtcaagctaggtttcaagtatgacaacattttg
atggaagaggctgctcagattctggagatagaaacttttatccctcttcttctacagaat
cctcaggatggatttagccgactaaaacgatggattatgattggcgatcatcaccagtta
cctccagttattaagaacatggcctttcaaaagtactcaaacatggagcagtctctcttc
actcgctttgttcgcgttggagttccgactgttgaccttgatgctcaagggagagccaga
gcaagcttgtgcaacctctacaactggcgatacaagaatctaggaaacttaccccatgtg
cagctcttgccagagtttagtacagcaaatgctggcttactgtatgacttccagctcatt
aatgttgaagattttcaaggagtgggagaatctgaacctaatccttacttctatcagaat
cttggagaggcagaatatgtagtagcactttttatgtacatgtgtttacttggttaccct
gctgacaaaatcagtattctaacaacatataatggccaaaagcatcttattcgcgacatc
atcaatagacgatgtggaaacaatccattgattggaagaccaaacaaggtgacaactgtt
gatagatttcaaggtcaacagaatgactatattcttctttctctggtacgaaccagggca
gtgggccatctgagggatgtccgtcgcttggtagtggccatgtctagagccagacttgga
ctttatatcttcgccagagtatccctcttccaaaactgttttgaactgactccagctttc
agtcagctcacagctcgcccccttcatttgcatataattccaacagaacctttcccaact
actagaaagaatggagagagaccatctcatgaagtacaaataataaaaaatatgccccag
atggcaaactttgtatacaacatgtacatgcatttgatacagactacacatcattatcat
cagactttattacaactaccacctgctatggtagaagagggtgaggaagttcaaaatcaa
gaaacagaattggaaacagaagaagaggccatgactgttcaagctgacatcatacccagt
ccaacagacaccagctgccgtcaagaaactccagcctttcaaactgacaccacccccagt
gagacaggagccacttccactccagaagccatccctgctttatctgagaccacccctact
gtggtaggagctgtatctgcaccggcagaagctaacacacctcaggatgccacatctgcc
ccagaagagaccaagtag

DBGET integrated database retrieval system