KEGG   Homo sapiens (human): 9719Help
Entry
9719              CDS       T01001                                 

Gene name
ADAMTSL2, GPHYSD1
Definition
ADAMTS-like 2
Organism
hsa  Homo sapiens (human)
Disease
H00900  
Geleophysic dysplasia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.2
AA seq 951 aa AA seqDB search
MDGRWQCSCWAWFLLVLAVVAGDTVSTGSTDNSPTSNSLEGGTDATAFWWGEWTKWTACS
RSCGGGVTSQERHCLQQRRKSVPGPGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCVSF
NSHVYNGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGICQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQPPHESRPQPIYYGFSESAESQGLDGAGL
MGFVPHNGSLYGQASSERLGLDNRLFGHPGLDMELGPSQGQETNEVCEQAGGGACEGPPR
GKGFRDRNVTGTPLTGDKDDEEVDTHFASQEFFSANAISDQLLGAGSDLKDFTLNETVNS
IFAQGAPRSSLAESFFVDYEENEGAGPYLLNGSYLELSSDRVANSSSEAPFPNVSTSLLT
SAGNRTHKARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSAYAMCVRYDGVEVD
DSYCDALTRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGYQFRVVRCWKMLSPGFDSS
VYSDLCEAAEAVRPEERKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCSEDEKLC
DPNTRPVGEKNCTGPPCDRQWTVSDWGPCSGSCGQGRTIRHVYCKTSDGRVVPESQCQME
TKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPECGLA
KKPPEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQ
ACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggatggcagatggcaatgttcctgctgggcctggttcctgctggttctggcagttgta
gctggggacacagtgtcaaccgggtccacggacaacagcccaacatccaatagcctggag
gggggcaccgacgccacggccttctggtggggggagtggaccaagtggacggcgtgttcc
cgcagttgcgggggtggggtgacatcccaggagcggcactgcctgcagcagaggaggaag
tccgtcccgggccccgggaacaggacctgcacgggcacgtccaagcggtaccagctctgc
agagtgcaggagtgtccgccggacgggaggagcttccgcgaggagcagtgcgtctccttc
aactcccacgtgtacaacgggcggacgcaccagtggaagcctctgtacccggatgactat
gtccacatctccagcaaaccgtgtgacctgcactgtaccaccgtggacggccagcggcag
ctcatggtccccgcccgcgacggcacatcctgcaagctcactgacctgcgaggggtttgc
gtgtctggaaaatgtgagcccatcggctgtgacggggtgcttttctccacccacacactg
gacaagtgtggcatctgccagggggacggtagcagctgcacccacgtgacgggcaactat
cgcaaggggaatgcccaccttggttactctctggtgacccacatcccggctggtgcccga
gacatccagattgtagagaggaagaagtccgctgacgtgctagctcttgcagacgaagct
ggctactacttcttcaacggcaactacaaggtggacagccccaagaacttcaacatcgca
ggcacggtggtcaagtacaggcggcccatggatgtctatgagaccggaatcgagtacatc
gtggcacaggggcccaccaaccagggcctgaatgtcatggtgtggaaccagaacggcaaa
agcccctccatcaccttcgagtacacgctgctgcagccgccacacgagagccgcccccag
cccatctactatggcttctccgagagcgctgagagccagggcctggacggggccgggctg
atgggcttcgtcccgcacaacggctccctctacggccaggcctcctcagagcggctgggc
ctggacaaccggctgttcggccacccgggcctggacatggagctgggccccagccagggc
caggagaccaacgaggtgtgcgagcaggccggcggcggggcctgcgaggggccccccagg
ggcaagggcttccgagaccgcaacgtcacggggactcctctcaccggggacaaggatgac
gaagaggttgacacccacttcgcctcccaggagttcttctcggctaacgccatctctgac
cagctgctgggcgcaggctctgacttgaaggacttcaccctcaatgagactgtgaacagc
atctttgcacagggcgccccaaggagctccctggccgagagcttcttcgtggattatgag
gagaacgagggggctggcccttacctgctcaacgggtcctacctggagctgagcagcgac
agggttgccaacagctcctccgaggccccattccccaacgttagcaccagcctgctcacc
tcggccgggaacaggactcacaaggccaggaccaggcccaaggcgcgcaagcaaggcgtg
agtcccgcggacatgtaccggtggaagctctcgtcccacgagccctgcagtgccacctgc
accacaggggtcatgtctgcgtacgccatgtgtgtccgctatgatggcgtcgaggtggat
gacagctactgtgacgccctgacccgtcccgagcctgtccacgagttctgcgctgggagg
gagtgccagcccaggtgggagacgagcagctggagcgagtgttcgcgcacctgcggagag
ggctaccagttccgcgtcgtgcgctgctggaagatgctctcgcccggcttcgacagctcc
gtgtacagcgacctgtgcgaggcagccgaggccgtgcggcccgaggaacgcaagacctgc
cggaaccccgcctgcgggccccagtgggagatgtcggagtggtccgagtgcactgccaag
tgtggggagcgcagtgtggtgaccagggacatccgctgctcggaggatgagaagctgtgt
gaccccaacaccaggcctgtaggggagaagaactgcacgggcccgccctgtgaccggcag
tggaccgtctccgactggggaccgtgcagtggaagctgcgggcaaggccgcaccatcagg
cacgtgtactgcaagaccagcgacggacgggtagtacctgagtcccagtgccagatggag
accaagcctctggccatccacccctgtggggacaaaaactgtcccgcccactggctggcc
caggactgggagcggtgcaacaccacctgcgggcgcggggtcaagaagcggctggtgctc
tgcatggagctggccaacgggaagccgcagacgcgcagtggccccgagtgcgggctcgcc
aagaagcctcccgaggagagcacgtgtttcgagaggccctgcttcaagtggtacaccagc
ccctggtcagagtgcaccaagacctgcggggtgggcgtgaggatgcgagacgtcaagtgc
taccaggggaccgacatcgtccgtggttgcgatccgttggtgaagcccgttggcagacag
gcctgtgatctgcagccctgccccacggagcccccagatgacagctgccaggaccagcca
ggcaccaactgtgccctggccatcaaagtgaacctctgcgggcactggtactacagcaag
gcgtgctgccgctcctgcaggcccccccactcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system