KEGG   Homo sapiens (human): 9724Help
Entry
9724              CDS       T01001                                 

Gene name
UTP14C, 2700066J21Rik, KIAA0266, UTP14B
Definition
UTP14, U3 small nucleolar ribonucleoprotein, homolog C (yeast)
Orthology
K14567  
U3 small nucleolar RNA-associated protein 14
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    9724 (UTP14C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q14.2
AA seq 766 aa AA seqDB search
MNVNQVAENLALSHQEELVDLPKNYPLSENEDEGDSDGERKHQKLLEAIISLDGKNRRKL
AERSEASLKVSEFSVSSEGSGEKLGLADLLEPVKTSSSLATVKKQLNRVKSKKVVELPLN
KEKIEQIHREVAFSKTSQVLSKWDPIILKNQQAEQLVFPLGKEQPAIAPIEHALSGWKAR
TPLEQEIFNLLHKNKQPVTDPLLTPMEKASLQAMSLEEAKMHRAELQRARALQSYYEAKA
RKEKKIKSKKYHKVVKKGKAKKALKEFEQLQKVNPTVALEEMEKIENARMMERMSLKHQN
SGKWAKSKAIMAKYDLEARQAMQEQLAKNKELTQKLQVASESEEEEGGTEVEELLVPHVA
NEVQMNVDGPNPWMFRSCTSDTKEAATQEDPEQVPELAAHEVSASEAEERPVAEEEILLR
EFEERQSLRKRSELNQDAEPASSQETKDSSSQEVLSELRALSQKLKEKHQSRKQKASSEG
TVPQVQREEPAPEEAEPLLLQRSERVQTLEELEELGKEDCFQNKELPRPVLEGQQSERTP
NNRPDAPKEKKEKEQLINLQNFLTTQSPSVRSLAVPTIIEELEDEEERDQRQMIKEAFAG
DDVIRDFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSAKKRRQFLIKAPEGPPRKD
KNLPNVIISEKRNIHAAAHQVQVLPYPFTHHRQFERTIQTPIGSTWNTQRAFQKLTTPKV
VTKPGHIIKPIKAEDVGYQSSSRSDLPVIQRNPKRITTRHNKEEKL
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaaccaggttgcagagaatctggctttgagccaccaggaagaactagtggat
ttgccaaaaaactaccccttgagtgaaaatgaagatgagggggacagtgatggagagaga
aagcatcaaaagcttctggaagcaatcatttcccttgatggaaagaataggcggaaattg
gctgagaggtctgaggctagtctgaaagtgtcagagttcagtgtcagttctgaaggatca
ggagaaaagctgggccttgcagatctgcttgagcccgttaaaacttcatcttctttggcc
actgtaaaaaagcaactgaatagagtcaaatcaaagaaggtggtggagttacctcttaac
aaagaaaaaattgaacagatccacagagaagtagcattcagtaaaacctcacaggtcctc
tccaaatgggaccctatcatcctgaagaaccagcaggcagagcagctggtttttcccctg
gggaaggagcagccagccattgctcccattgaacatgcgctcagtggctggaaggcaaga
actcccctggagcaggaaatttttaacctcctccataagaacaagcagccagtgacagat
cctttactgactcccatggaaaaggcctctctccaagccatgagcctggaagaggcaaag
atgcaccgagcagagcttcagagggctcgggctctgcagtcctactatgaggccaaggct
cgaaaagagaagaaaatcaaaagtaaaaagtatcacaaagtcgtgaagaaaggaaaggcc
aagaaagccttaaaagagtttgagcagctacagaaggttaatccaactgtggcactggaa
gaaatggaaaaaattgaaaatgccagaatgatggaaagaatgagccttaagcaccaaaac
agtgggaaatgggccaagtcaaaggcaattatggccaaatatgacctggaggctcgccaa
gctatgcaggaacagttggccaagaacaaagaactgacacagaaactccaggtagcctct
gagagtgaggaagaggagggaggcacagaagtggaagaactccttgtccctcatgtagcg
aatgaagtgcagatgaatgtggacggaccgaatccctggatgttcaggagctgcaccagt
gacaccaaagaggctgcaacacaggaggaccctgagcaagtgccagagcttgcagctcat
gaggtttctgcaagtgaggcagaagaaagaccagtggcagaggaagaaattttgttgaga
gaatttgaggaaaggcaatcccttagaaaaagatctgagctcaaccaggatgctgagcca
gcaagcagtcaagaaacaaaagattctagcagccaggaggtgctgtccgaattgagggca
ctatctcagaaattgaaggaaaaacatcagtccaggaagcaaaaagcaagttcagagggg
actgttccccaggtccagagagaggaacctgccccagaagaagcggaacccctattgcta
cagaggtcagagagagtacaaactctggaagagctagaagagctgggaaaagaagattgt
tttcaaaataaggagcttcccagacctgtgttagaaggacagcagtcagagaggacccca
aataatcggcctgatgcccctaaggagaagaaagagaaggagcaactgatcaacctacag
aacttcctgaccacacagtctccttccgtgaggtctttggcagttcccacaataatagag
gagctggaagatgaagaggagagagaccaaaggcagatgataaaggaagcttttgctggg
gatgatgtcatcagagatttcttgaaagagaagagggaagctgtggaggcgagtaagcca
aaggacgtggacctgacactacctggctggggcgagtggggtggtgtgggcctaaagccc
agtgccaagaaaagacgccagtttctcattaaagcccctgagggtcctccaagaaaagat
aagaatttgccaaatgtgattatcagtgagaagcgcaacatccacgcagcagctcatcag
gtacaagtgcttccatatccatttacccaccatcggcaatttgaaaggaccatccagacc
cctataggatccacatggaacacccagagggctttccaaaagctgactactcccaaggtc
gtcaccaagccaggccatatcattaagcccataaaagcagaggatgtgggctaccagtct
tcctcaaggtcagacctgcctgtcatacagaggaatccaaaacgaatcaccacacgtcac
aataaagaagaaaaactgtag

DBGET integrated database retrieval system