KEGG   Homo sapiens (human): 9727Help
Entry
9727              CDS       T01001                                 

Gene name
RAB11FIP3, CART1, Rab11-FIP3
Definition
(RefSeq) RAB11 family interacting protein 3 (EC:2.7.4.6)
  KO
K12485  
Rab11 family-interacting protein 3/4
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    9727 (RAB11FIP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 756 aa AA seqDB search
MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAP
GAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELD
PLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGS
PPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVK
DLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTY
EANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEE
PDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLT
PSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDT
AATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIE
IENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRM
GDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARE
SELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDEL
MEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggccccgccggcctcgcccccgggctcggagccgccggggcccgacccggag
ccgggcgggccggacgggccgggggcggcacaactggctccgggccctgcggagctacgc
ctcggagcgcccgtcggcggccccgacccgcagtccccgggcctggatgagcctgcgccc
ggggccgctgcagatggcggggcgcgttggagcgccgggccggccccggggctggaggga
ggcccgcgagaccccgggccgtccgccccgccgccgcgctccggcccgcgggggcagctt
gcgagccccgacgccccgggcccagggccgcgctccgaagcgccgcttccagaactcgac
ccgttgttctcctggactgaggagcccgaggagtgtggccccgcgagctgcccggagagc
gcgcctttccgcttgcaggggtccagcagcagccaccgagcgcggggcgaggtcgacgtc
ttctctcccttccccgcgcccacggcgggcgagctggcgctggagcaaggtcccgggtcc
ccgccgcagccctcggacctcagccagacccacccccttccgagcgagcccgtggggagt
caggaggacggcccccgcctccgagccgtgttcgatgccctggacggggatggggacggt
ttcgtccgcatcgaggacttcatccagtttgctacggtctacggggcagagcaggtgaag
gacttaactaagtacttggatcccagtgggctcggcgtgatcagctttgaagacttctac
caagggatcacagccatcagaaacggagatcctgatggccagtgctacggtggtgtcgct
tctgcccaagatgaggagcccctggcctgcccggacgagttcgatgacttcgtcacctat
gaggccaacgaggtgacggacagcgcgtacatgggctccgagagcacctacagtgagtgt
gagaccttcacggacgaggacaccagcaccctggtgcaccctgagctgcaacctgaaggg
gacgcagacagtgccggcggctcggccgtgccctctgagtgcctggacgccatggaggag
cccgaccatggtgccctgctgctgctcccaggcaggcctcacccccatggccagtctgtc
atcacggtgatcgggggcgaggagcactttgaggactacggtgaaggcagtgaggcggag
ctgtccccagagaccctatgcaacgggcagctgggctgcagtgaccccgctttcctcacg
cccagtccgacaaagcggctctccagcaagaaggtggcaaggtacctgcaccagtcaggg
gccctgaccatggaggccctggaggacccttcccccgagctcatggagggcccagaggag
gacattgctgacaaggttgtcttcctggaaaggcgtgtgctggagctggaaaaggacacg
gcagccaccggtgagcaacacagccgcctgaggcaggagaacctgcagctggtgcacaga
gcaaacgccctggaggagcagctgaaggagcaggagctgagagcctgcgagatggtcctg
gaagagacccggcgtcagaaggagctcctgtgcaagatggagagggagaagagcattgag
atcgagaacctgcagaccaggctacagcaactggacgaggagaacagtgaactccggtcc
tgcacgccctgtctgaaggccaacattgagcgtctggaggaggagaagcagaagctgttg
gatgagatagagtcgctgacgctgcggctcagtgaagagcaggagaacaagaggagaatg
ggggacaggctgagtcacgagaggcaccagttccagagggacaaggaggccacccaggag
ctgatcgaggacctccgaaagcagctggagcacctgcagctcctcaagctggaggccgag
cagcggcggggccgcagcagcagcatgggcctgcaggagtaccacagccgcgcccgggag
agcgagctggagcaggaggtccgcaggctgaagcaggacaaccgcaacctgaaggagcag
aacgaggagctgaacgggcagatcattaccctcagcatccagggcgccaagagcctcttc
tccacagccttctctgagtccctggctgcagagatcagctccgtctcccgagatgagctc
atggaggcgattcagaagcaggaggagatcaacttccgcctgcaggactacatcgacagg
atcatcgtggccatcatggagaccaacccgtccatcctggaggtcaagtag

DBGET integrated database retrieval system