KEGG   Homo sapiens (human): 973Help
Entry
973               CDS       T01001                                 

Gene name
CD79A, IGA, MB-1
Definition
(RefSeq) CD79a molecule
  KO
K06506  
CD79A antigen
Organism
hsa  Homo sapiens (human)
Pathway
B cell receptor signaling pathway
Primary immunodeficiency
Disease
H00085  
Agammaglobulinemias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    973 (CD79A)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    973 (CD79A)
Cellular antigens [BR:hsa04090]
 Proteins
  973 (CD79A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 226 aa AA seqDB search
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSN
NANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCG
TYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGD
EYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggggtccaggagtcctccaagctctgcctgccaccatcttcctcctcttcctg
ctgtctgctgtctacctgggccctgggtgccaggccctgtggatgcacaaggtcccagca
tcattgatggtgagcctgggggaagacgcccacttccaatgcccgcacaatagcagcaac
aacgccaacgtcacctggtggcgcgtcctccatggcaactacacgtggccccctgagttc
ttgggcccgggcgaggaccccaatggtacgctgatcatccagaatgtgaacaagagccat
gggggcatatacgtgtgccgggtccaggagggcaacgagtcataccagcagtcctgcggc
acctacctccgcgtgcgccagccgccccccaggcccttcctggacatgggggagggcacc
aagaaccgaatcatcacagccgaggggatcatcctcctgttctgcgcggtggtgcctggg
acgctgctgctgttcaggaaacgatggcagaacgagaagctcgggttggatgccggggat
gaatatgaagatgaaaacctttatgaaggcctgaacctggacgactgctccatgtatgag
gacatctcccggggcctccagggcacctaccaggatgtgggcagcctcaacataggagat
gtccagctggagaagccgtga

DBGET integrated database retrieval system