KEGG   Homo sapiens (human): 9732Help
Entry
9732              CDS       T01001                                 

Gene name
DOCK4
Definition
(RefSeq) dedicator of cytokinesis 4
  KO
K17697  
dedicator of cytokinesis protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    9732 (DOCK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31.1
AA seq 1966 aa AA seqDB search
MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSS
YVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMN
EILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITEL
YRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLR
LNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
FGCAVLSIADLLTGETKDDLILKVYMCNTESEWYQIHENIIKKLNARYNLTGSNAGLAVS
LQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSV
ARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKF
RGAHIRFEFRHCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTT
RYLKLPFSKGIFLGNNNQAMKATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITGC
LSKLKEIDGSEIVKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPV
MDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFS
LATGGQNEEEFRCCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAVYSELLKLFDV
REVANLVQDTLGSLPTILHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHI
HLQEQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQPS
SSAMRFQFQDVTGEFVACLLSLLRQMTDRHYQQLLDSFNTKEELRDFLLQIFTVFRILIR
PEMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCL
QLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPALIGPFLEVTLIPQPD
LRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIE
RETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYKTELNKEEMYI
RYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQRKEHLHLTII
QNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVG
FYGKKFPFFLRNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDETIFQAEAQYL
QIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVER
TSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINP
LTMCLNGVIDAAVNGGVSRYQEAFFVKEYILSHPEDGEKIARLRELMLEQAQILEFGLAV
HEKFVPQDMRPLHKKLVDQFFVMKSSLGIQEFSACMQASPVHFPNGSPRVCRNSAPASVS
PDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLS
STHSASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRERPCSAIYPTPVEPSQRMLFN
HIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPPRPTQTASP
ARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTS
ETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSL
SIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
NT seq 5901 nt NT seq  +upstreamnt  +downstreamnt
atgtggatacctacggagcacgagaaatacggcgtggttattgccagtttccgaggaacc
gttccatatggcctgtcattggaaattggagatacagttcagatcctggagaagtgtgat
ggctggtacagaggatttgccttaaaaaacccaaatatcaagggtatatttccttccagc
tacgttcacttgaaaaatgcctgtgtaaagaacaaaggacaatttgaaatggttattccc
actgaagactctgttatcacagaaatgacatcaacattaagagactggggaaccatgtgg
aaacaactctatgtgcgtaatgaaggcgatctcttccaccggctgtggcacatcatgaat
gaaatcctggacctgaggcggcaggtgctggtgggccacctcacccacgaccggatgaag
gacgtgaagcgccacattactgcccggcttgactggggcaatgaacaactgggactggac
ctggtgcctaggaaagagtacgcaatggtggatccggaagacatcagcattactgagctc
taccgattgatggaacatcgacatcggaagaaagacaccccggtgcaggccagcagtcac
cacctctttgtccagatgaagagcctcatgtgttccaacctgggagaggagctggaggtc
atcttctcactctttgacagtaaagagaaccggccaatcagtgagagatttttcttgagg
ctgaatagaaacgggcttcccaaagcccctgataaaccggaacgacattgctccctcttt
gtggatttgggcagcagtgagctaagaaaggacatttatatcaccgtgcacattatccga
atcggtcgaatgggagcaggagaaaaaaagaatgcctgtagtgtccagtaccgacgaccc
tttggctgtgcagttcttagcatcgctgacctgctaacaggagagacaaaggatgacctc
attctgaaagtatacatgtgtaacacagagagtgagtggtaccaaatccatgagaacatc
atcaaaaagctgaatgcacgttataacttgactggctccaatgcaggtttagcagtttcc
ttacagctattgcacggagacattgaacaaatcagaagggaatattcatcagtattttct
catggagtatccataacaaggaagctgggattttcaaatattattatgcctggtgaaatg
aggaatgatttatatatcactattgaaaggggagaatttgagaaaggagggaagagcgtg
gccagaaatgtggaagttacgatgttcattgtagacagtagtggccaaaccctgaaggat
tttatctccttcggctctggggagccaccagccagtgagtaccactcctttgtgctttac
cataacaacagtcccaggtggtctgaactgctgaaacttcccattcctgtggataaattc
cggggtgcacacatccgcttcgagtttcggcattgttccacaaaggagaaaggagagaag
aagttgtttgggttttcttttgtccctctgatgcaagaagatggtaggactcttccagat
ggcactcatgagctcatcgtgcataagtgtgaagaaaacacaaatcttcaggatactacc
cgctacctcaaacttcccttttccaagggcattttccttgggaataataatcaagccatg
aaggccacaaaggagtccttttgtattacatcttttctctgttccacaaaactcacacaa
aatggtgatatgcttgatcttttgaaatggagaacccacccagacaagatcactggctgt
ctctctaaattaaaagaaattgatggctcagagatagtaaagtttctgcaggatacactg
gataccttatttggaattttagatgaaaattcccaaaaatatgggtctaaagtgtttgat
tctttggttcacataataaatttgctgcaagatagcaaatttcatcattttaaacctgta
atggacacttacattgagagtcattttgctggggcacttgcatacagagatctcatcaaa
gtgctcaaatggtacgtggaccggatcacagaagcagagcggcaagagcatatccaggag
gtgctgaaggcacaagaatacatttttaagtatatagttcaatctcgaaggctgttttcc
cttgccactggtgggcaaaacgaagaggagttccgctgctgcattcaggagcttctcatg
tcagtccgtttctttctttcgcaagagagcaaagggtctggagcattatctcagtcacag
gctgtgtttctgagctctttccctgccgtgtactcagaactgttgaagctctttgatgtc
cgggaagtagccaacttggtccaggacaccctgggcagtctgccgaccatcctgcatgtg
gatgattccctgcaggccatcaaactgcagtgcattggcaaaaccgtggaaagccagctt
tataccaacccagattcccgatacattcttctgcctgtcgtgttacatcacctccacatt
cacttgcaagaacagaaggacctgatcatgtgtgcacgtatccttagcaacgtattttgt
cttatcaagaaaaatagctcagaaaaatctgtgctggaggaaatagatgtgatagtggcc
agcttgctggatattctgctgaggaccatattggagatcaccagccgacctcagccatcc
agctcagcaatgcggttccagttccaggatgtcactggggagtttgttgcttgtctcctg
tccctattacgacaaatgacagatagacattatcaacagcttcttgatagttttaataca
aaggaagaactaagggatttcctgctgcagatatttactgtgttccgaatattgatacgc
ccggagatgtttccaaaggactggactgttatgcgcttggttgctaacaatgttattatt
acaacagttctatacctctcagatgcacttcgtaagaacttcttaaatgaaaactttgat
tataagatctgggattcctacttttacctcgcagtcatttttataaaccagttgtgtctg
cagttggagatgttcacaccttccaagaagaaaaaggtgttagaaaagtatggtgacatg
cgggtaacaatgggttgtgaaattttcagcatgtggcaaaacctaggagagcacaagctt
cattttatccctgccctgattggccccttcctagaagtgaccttgataccccagccagat
cttcggaatgtcatgattccaatttttcatgatatgatggactgggagcagaggcggagt
ggcaactttaaacaggtggaagccaagctaattgacaaactggatagcctgatgtcagaa
ggcaaaggtgacgaaacataccgcgagctcttcaacagtattctactaaagaaaattgag
cgggaaacatggcgggaaagtggcgtttcattaattgctactgtaactcgtctaatggag
aggttgttagattacagggactgcatgaaaatgggagaggtagatggcaaaaagattggc
tgcacagttagccttctgaacttctataagactgaactgaacaaggaggagatgtatata
cgctacattcacaaactctatgatctgcatctcaaagcacagaactttacagaagctgca
tataccctcctcttatatgacgagctactggaatggtctgatcggcccctcagggagttc
ctgacctaccccatgcaaacagaatggcagcgcaaagagcacctgcacctcaccatcatc
cagaactttgacagaggcaaatgttgggagaatggcattatcttgtgccggaagattgca
gagcagtatgagagttattatgactacagaaacctgagcaagatgcggatgatggaagcc
tctttgtatgacaaaattatggaccagcaacgtcttgaaccagagttcttcagagttgga
ttttatggaaaaaaatttccatttttcttaagaaataaggagtttgtgtgtcgagggcat
gactacgagaggctggaagccttccaacagagaatgctgaacgagttcccccatgccatc
gccatgcagcacgccaaccagcccgatgagaccatcttccaggcagaagctcagtatttg
cagatatatgctgtgactcccattccagagagccaggaggtcctgcagagagagggtgtt
ccggacaacatcaaaagcttctataaagtgaatcacatctggaaattccgctatgaccga
ccatttcacaaaggcacaaaagataaagagaatgaattcaagagtctctgggtggagaga
acgtcattatacttggtgcagagtttgcctggcatctctcgctggtttgaagtggaaaag
cgtgaagtggtagaaatgagtcctctggaaaatgcaattgaagtgctagaaaataagaat
cagcagctgaagactctgattagtcagtgtcagacaagacagatgcagaatattaatccc
ctgactatgtgcctgaatggagttatagatgctgcagttaatggtggcgtttccaggtat
caagaggcattctttgtcaaagaatatatcttaagtcaccctgaagatggggagaaaatt
gcacgattaagagagctgatgcttgagcaggcacagattctggaatttggtttggccgtg
catgagaagtttgtacctcaagatatgagaccccttcacaaaaagctggttgaccaattc
tttgtgatgaagtcgagcttagggatacaggagttctctgcttgtatgcaagccagtcct
gtccattttcctaatggaagccctcgtgtgtgtagaaactcagcacctgcttctgtgagc
ccagatggtaccagggtaattcctagacgcagcccgttaagttacccagctgtcaaccga
tattcttcctcctcactgtcctcacaagcttctgctgaagtaagcaatattacagggcaa
tcagaaagctctgatgaagtctttaacatgcagccaagtccatctacctcaagcttgagt
tctactcactcggcttcacctaatgtgacaagttctgctccatcgagtgccagagcttct
cctttgttgtctgacaaacacaaacattcccgagaaaactcttgcctgtcaccaagagag
agaccatgcagtgccatctatccaacacctgtggagccttcgcagaggatgctgtttaat
catattggagacggggccttgccacgcagtgacccaaatctctctgcacctgaaaaagct
gtgaaccccacccctagcagctggagcctggacagtgggaaggaagccaagaacatgtcg
gatagtgggaaacttatctctccccctgtccctccaagacccacacagactgcttcacca
gcaagacacacgacatcagtatccccctcgcctgccgggcgatctccattgaagggctct
gtgcagtctttcaccccctctccagtggagtaccactcgccaggactcatctccaactcc
cctgtcttgtcgggcagctacagcagtgggatttcttctctcagccggtgcagcacgtcg
gaaacctcaggctttgaaaatcaggtgaatgaacagtcggcccccctgccggtgccagtg
ccggtgcccgtgccgagctacggcggggaggagccagtgcgcaaggagagcaagactccg
cccccgtacagcgtctacgagcggactctgcggcgccccgtcccgctacctcacagcctc
tccatccccgtcacgtcggagccgcccgcgctgccccccaagcctctggcagcgcgatcc
agccacctggagaatggggcccggaggactgaccccggcccgcggcccaggcccctgccc
cgcaaggtctctcagttataa

DBGET integrated database retrieval system