KEGG   Homo sapiens (human): 9739Help
Entry
9739              CDS       T01001                                 

Gene name
SETD1A, KMT2F, Set1, Set1A
Definition
(RefSeq) SET domain containing 1A
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    9739 (SETD1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     9739 (SETD1A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     9739 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     9739 (SETD1A)
    COMPASS/SET1 complex (yeast)
     9739 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15047(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 1707 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETAESRRRSSSDTAAYPAGTTAVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDAFSRRHFSASSASTTASTAIAATTAATASSSASSSSLSSSSSSSSSSSSSQFR
SSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRP
TDQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEVRTSPRPASPARSGSPAPETTNESV
PFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSMVLGARDTGSEVPSGSGHGPCT
PPPAPANFEDVAPTGSGEPGATRESPKANGQNQASPCSSGDDMEISDDDRGGSPPPAPTP
PQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFV
NSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLIAASAGPPGGAFGEAFLPFPP
PQEAAYGLPYALYAQGQEGRGAYSREAYHLPMPMAAEPLPSSSVSGEEARLPPREEAELA
EGKTLPTAGTVGRVLAMLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNA
AKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEP
SEISEASEEKRPRPSTPAEEDEDDPEQEKEAGEPGRPGTKPPKRDEERGKTQGKHRKSFA
LDSEGEEASQESSSEKDEEDDEEDEEDEDREEAVDTTKKETEVSDGEDEESDSSSKCSLY
ADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEDEEEEERPAALPSASPP
PREVPVPTPAPVEVPVPERVAGSPVTPLPEQEASPARPAGPTEESPPSAPLRPPEPPAGP
PAPAPRPDERPSSPIPLLPPPKKRRKTVSFSAIEVVPAPEPPPATPPQAKFPGPASRKAP
RGVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRLTEEEEAEPGTEVDLAVLADLA
LTPARRGLPALPAVEDSEATETSDEAERPRPLLSHILLEHNYALAVKPTPPAPALRPPEP
VPAPAALFSSPADEVLEAPEVVVAEAEEPKPQQLQQQREEGEEEGEEEGEEEEEESSDSS
SSSDGEGALRRRSLRSHARRRRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSEDM
SYLRLTYERLLQQTSGADWLNDTHWVHHTITNLTTPKRKRRPQDGPREHQTGSARSEGYY
PISKKEKDKYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLKL
NQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIG
SSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEI
TYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaggccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccctgcgcaggccttctcagaaggtgtac
cgctatgatggagtccacttcagtgtcaacgactcaaagtatataccagtcgaagacctc
caagacccccgttgccatgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggacgagttctatattggacagattccactgaaggaagtgacttttgcaagg
ctgaatgacaacgtgcgggagaccttcctgaaggatatgtgccgtaagtacggtgaggtg
gaagaggtagagatcctccttcacccccgtacgcgcaagcacctgggcctggcccgtgtg
ctcttcaccagcactcggggcgccaaggaaacggtcaaaaacctccaccttacctccgtc
atgggcaacatcatccatgcccagcttgacatcaaaggacaacaacgaatgaaatactat
gaactaattgtcaatggctcctacacccctcagactgtgcccactgggggcaaggccctg
agtgagaagttccaaggctcgggtgcagccactgagacggccgaatcccgccgccgctct
tcctctgacacagctgcctacccagcaggcaccactgcggtgggcactcctggcaacggc
accccctgctcccaggacacaagcttctccagcagccgacaagataccccatcttccttt
ggccagttcacacctcagtcctcccaaggaaccccctacacgtctcggggcagcaccccc
tactctcaggactctgcctactccagcagcaccacttcaacctccttcaagccccggcgg
tcagagaacagctaccaagatgccttttcccgccgccacttctctgcatcttcagcctcc
acaaccgcctccacggccatcgccgccaccactgcagccactgcctcatcctccgcctct
tcctcctcattgtcctcgtcctcctcgtcatcctcttcctcctcgtcctctcagtttcgt
agttctgatgcaaactacccagcgtattatgaaagctggaatcgctaccagcgccatact
tcctacccaccacgccgggccacacgggaggaaccccctggagccccttttgctgaaaat
acagctgagcgcttcccaccttcttacacctcctacctgccccccgagcccagccggccc
accgaccaggactaccggcctcctgcctcagaggctccacccccggagcctccagaacct
ggtggaggcgggggtggaggagggcccagccctgagagagaagaagttcggacttccccc
cgcccagcctcccctgcccgctctggctccccagccccggagaccaccaatgagagtgtg
cccttcgcccagcacagcagcctggattcccgcatcgagatgctgctgaaggagcagcgc
tccaagttttccttcttggcctctgacacagaggaggaggaagagaacagcagcatggtc
cttggggccagagatacagggagtgaggtgccttctgggtcagggcatgggccctgcaca
ccccctccggccccagctaattttgaggatgtggcacctacagggagcggggagccaggg
gctacccgggagtctcccaaggcaaatggacagaaccaggcttctccatgctcttctgga
gacgacatggagatctccgacgacgaccggggtggctcaccccctccggccccgacgccc
cctcagcagcctccgccacctccccctcccccgccgcctcctcctccctacctggcgtcc
cttcctcttggttatcctccccaccaacctgcctacctcctcccacccagacctgatggg
ccgccgccccctgagtaccccccacctcctccaccacccccgcacatctatgactttgtg
aactccttggagctcatggaccgacttggggctcagtggggagggatgcccatgtccttc
cagatgcagacccagatgttaactcggctccatcagctgcggcagggcaagggattgatt
gccgcctcagctggcccccccggtggggcctttggggaggccttcctcccgtttccaccc
ccgcaggaggcagcctacggcttgccgtatgctctatatgcacaggggcaggagggcaga
ggggcatactcacgggaggcctaccacctgcccatgccaatggcagccgagcccctgccc
tcctcctcagtctcgggagaggaggcccggctgccacccagggaagaagcagagctggca
gagggcaagaccctcccgacagcaggcaccgtgggccgtgtgctcgccatgctggtccag
gagatgaagagcatcatgcagcgagacctcaaccgcaagatggtggagaacgtggccttc
ggagcctttgaccagtggtgggagagcaaggaggagaaggccaagccattccagaacgcg
gccaagcagcaagccaaggaggaggataaagagaagacgaagctgaaggagcctggcctg
ctgtccctcgtggactgggccaagagcgggggcactacgggcatcgaggctttcgccttt
gggtcagggctgagaggggccctgcggctgccttcattcaaggtaaagcggaaagagcca
tcggaaatttccgaggccagtgaggaaaagaggcctcgtccctccactcctgctgaggaa
gatgaagacgaccctgaacaagagaaggaggctggagagccaggacgtccggggaccaag
cccccgaagcgggacgaagagcgaggcaagacccagggcaagcaccgcaagtcctttgct
ctggacagcgaaggggaggaggcatcccaggagtcctcctcggagaaggatgaggaggat
gacgaggaagatgaggaagatgaagatcgagaggaagctgtggataccacaaagaaggag
acagaggtgtcggatggcgaggacgaggaaagcgattcgtcttccaaatgttctctgtat
gctgactcagatggcgaaaatgacagcacatcagactccgagagcagcagctcttccagc
tcctcatcctcctcctcctcctcgtcctcatcctcctcgtcctcttcatcctctgagtcc
tcctctgaagatgaagaggaagaggagcggccagcagcccttccctcagcctccccgccc
cccagagaagtcccagtgcccacgccagcacctgtggaggtgccagtgccggaaagggtt
gcaggctccccagtcacacccctgcccgaacaggaggcgtctccagcaaggcctgcaggc
cccacggaggagtcaccccccagtgcgcctctgcgtcccccagaaccacctgctgggccc
ccggcccctgccccacgccccgatgagcgtccctcttctcccatccccctcctgccccca
cccaagaaacgccggaaaactgtctccttctctgccatcgaggtggtgccagccccggag
ccccctccagccacaccgccgcaggccaagtttcccggcccagcctcccgcaaggctccc
cggggcgtggagcggaccatccgcaacctgcccctggaccacgcatctctggtcaagagt
tggcccgaggaggtgtcccgaggaggccggagccgggctggaggccgaggccgcctcacc
gaggaagaggaggctgagccagggacagaggtggacctggcggtcctggccgacctggcc
ctgacccctgcccggcgcgggctgcctgccctgcctgctgttgaagactcagaggccaca
gagacatcggacgaggccgagcgccctaggcccctgctcagccacatcctcctggagcac
aactatgccctggccgtcaagcccacgccccctgcgccagccctgcggcccccggagcca
gtgcccgcacccgccgccctcttcagttccccagctgatgaggtcctggaggcccccgag
gtggtggtggctgaggcggaggagcccaagccgcagcaactgcagcagcagcgggaggag
ggcgaagaggagggggaggaagagggggaggaagaggaggaggagtcctctgacagcagc
agcagcagcgatggggagggcgccctccggaggcgcagcctccgctcccacgcccggcgc
cgccgccctccgcccccacccccgccgccaccgccccgcgcctacgagccacgcagtgag
tttgaacagatgaccatcctgtatgacatttggaactcgggcctggactcagaggacatg
agttacctgcggcttacgtacgagcggctgctgcagcagacaagcggggctgactggctc
aacgacactcactgggtccatcacacaatcaccaacctgaccaccccaaaacgcaagcgg
cggccccaggatgggccccgggagcaccagacaggctcagcccgcagcgaaggctactac
cccatcagcaagaaggagaaggacaagtacctggacgtgtgcccagtctcggcccggcag
ctggagggcgtggacactcaggggacgaaccgcgtgctgtccgagcgccggtccgagcag
cggcggctgctgagcgccatcggtacctccgccatcatggacagtgacctgctgaaactc
aaccagctcaagttccggaagaagaagctccgatttggccggagccggatccacgagtgg
ggtctgtttgccatggaacccattgctgctgacgagatggtcatcgaatacgtgggtcag
aacatccgtcagatggtggccgacatgcgggagaagcgctacgtgcaggagggcattggc
agcagctacctgttccgggtggaccacgacaccatcatcgatgccaccaagtgtggcaac
ctggccagattcatcaaccactgctgcacgcctaactgctacgccaaggtcatcaccatc
gagtcccagaagaagatcgtgatctactccaagcagcccattggcgtggacgaggagatc
acctacgactacaagttcccactggaagacaacaagatcccgtgtctgtgtggcacagag
agctgccggggctccctaaactga

DBGET integrated database retrieval system