KEGG   Homo sapiens (human): 9748Help
Entry
9748              CDS       T01001                                 

Gene name
SLK, LOSK, STK2, bA16H23.1, se20-9
Definition
(RefSeq) STE20 like kinase (EC:2.7.11.1)
  KO
K08836  
STE20-like kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    9748 (SLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9748 (SLK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   9748 (SLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.33
AA seq 1235 aa AA seqDB search
MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLA
AAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVM
LELERPLTESQIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKN
TRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNP
MRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDARWTTSQLLQHPFVTVDSNKPI
RELIAEAKAEVTEEVEDGKEEDEEEETENSLPIPASKRASSDLSIASSEEDKLSQNACIL
ESVSEKTERSNSEDKLNSKILNEKPTTDEPEKAVEDINEHITDAQLEAMTELHDRTAVIK
ENEREKRPKLENLPDTEDQETVDINSVSEGKENNIMITLETNIEHNLKSEEEKDQEKQQM
FENKLIKSEEIKDTILQTVDLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKD
VISNTSDVIGTCEAADVAQKVDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKEV
PIKEIVEMNEIEEGKNKEQAINSSENIMDINEEPGTTEGEEITESSSTEEMEVRSVVADT
DQKALGSEVQDASKVTTQIDKEKKEIPVSIKKEPEVTVVSQPTEPQPVLIPSININSDSG
ENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSFLSKTKDSGSI
SLQETRRQKKTLKKTRKFIVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELRFLQKE
EQRAQQQLNSKLQQQREQIFRRFEQEMMSKKRQYDQEIENLEKQQKQTIERLEQEHTNRL
RDEAKRIKGEQEKELSKFQNMLKNRKKEVINEVEKAPKELRKELMKRRKEELAQSQHAQE
QEFVQKQQQELDGSLKKIIQQQKAELANIERECLNNKQQLMRAREAAIWELEERHLQEKH
QLLKQQLKDQYFMQRHQLLKRHEKETEQMQRYNQRLIEELKNRQTQERARLPKIQRSEAK
TRMAMFKKSLRINSTATPDQDRDKIKQFAAQEEKRQKNERMAQHQKHENQMRDLQLQCEA
NVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQ
EVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcttcaatttccgtaagatcttcaagttggggagcgagaagaagaagaagcag
tacgaacacgtgaagagggacctgaaccccgaagacttttgggagattataggagaactg
ggcgacggagcctttgggaaagtgtacaaggcccagaataaagagaccagtgttttagct
gctgcaaaagtgattgacactaaatctgaagaagaacttgaagattacatggtagagatt
gacatattagcatcttgtgatcacccaaatatagtcaagcttctagatgccttctattat
gagaacaatctttggatcctcattgaattttgtgcaggtggagcagtagatgctgtgatg
cttgaacttgagagaccattaactgagtcccaaatacaagtagtttgcaagcagacttta
gatgcattgaactacttacatgataataagatcatccacagagatctgaaggctggcaac
attctctttaccttagatggagatatcaaattggcggattttggagtatcagctaaaaac
acgaggacaattcaaagaagagattcctttattggtacaccatattggatggctcctgaa
gtagtcatgtgtgaaacatctaaggacagaccctatgactacaaagctgatgtttggtcc
ctgggtatcactttaatagaaatggctgagatagaaccacctcatcatgaattaaatcca
atgcgagtgctgctaaaaatagcaaaatctgagccacctacattagcacagccatccaga
tggtcttcaaattttaaggactttctaaagaaatgcttagaaaagaatgtggatgccagg
tggactacatctcagctgctgcagcatccctttgttactgttgattccaacaaacccatc
cgagaattgattgcagaggcgaaggctgaagtaacagaagaagttgaagatggcaaagag
gaagatgaagaggaggaaacagaaaattctctgccaatacctgcaagtaagcgtgcatct
tctgaccttagtatcgccagctctgaagaagataaactttcacaaaatgcttgtattttg
gagtctgtctcagaaaaaacagaacgtagtaactctgaagataaactcaacagcaaaatt
cttaatgaaaaacccaccactgatgaacctgaaaaggctgtggaggatattaatgaacat
attaccgatgctcagttagaagcaatgactgaactccatgacagaacagcagtaatcaag
gagaatgaaagagagaagaggcccaagcttgaaaatctgcctgacacagaagaccaagaa
actgtggacattaattcagtcagtgaaggaaaagagaataatataatgataaccttagaa
acaaatattgaacataatctaaaatctgaggaagaaaaggatcaggaaaagcaacagatg
tttgaaaataagcttataaaatctgaagaaattaaagatactattttgcaaacagtagat
ttagtttctcaagagactggagaaaaagaggcaaatattcaggcagttgatagtgaagtt
gggcttacaaaggaagacacccaagagaaattgggggaagacgacaaaactcaaaaagat
gtgatcagcaatacaagtgatgtgataggaacatgtgaggcagcagatgtggctcagaaa
gtggatgaagacagtgctgaggatacgcagagtaatgatgggaaagaagtggtcgaagta
ggccagaaattaattaataagcccatggtgggtcctgaggctggtggtactaaggaagtt
cctattaaagaaatagttgaaatgaatgaaatagaagaaggtaaaaataaggaacaagca
ataaacagttcagagaacataatggacatcaatgaggaaccaggaacaactgaaggtgaa
gaaatcactgagtcaagtagcactgaagaaatggaggtcagaagtgtggtggctgatact
gaccaaaaggctttaggaagtgaagttcaggatgcttctaaagtcactactcagatagat
aaagagaaaaaagaaattccagtgtcaattaaaaaagagcctgaagttactgtagtttca
cagcccactgaacctcagcctgttctaatacccagtattaatatcaactctgacagtgga
gaaaataaagaagaaataggttctttatcaaaaactgaaactattctgccaccagaatct
gagaatccaaaggaaaatgataatgattcaggcactggttccactgctgatactagcagt
attgacttgaatttatccatctctagctttctaagtaaaactaaagacagtggatcgata
tctttacaagaaacaagaagacaaaagaaaacattgaagaaaacacgcaaatttattgtt
gatggtgtagaagtgagtgtaacaacatcaaagatagttacagatagtgattccaaaact
gaagaattgcggtttcttagacgtcaggaacttcgggaattaagatttcttcagaaagaa
gagcaaagagcccaacaacagctcaatagcaaactacagcaacaacgagaacaaattttc
cggcgctttgagcaggaaatgatgagtaaaaagcgacaatatgaccaggaaattgagaat
ctagaaaaacagcagaaacagactatcgaacgcctggaacaagagcacacaaatcgcttg
cgagatgaagccaaacgcatcaaaggagaacaagagaaagagttgtccaaatttcagaat
atgctgaagaaccgaaagaaggaggttataaatgaagtggagaaagcacccaaagagctg
agaaaagagctcatgaaacgcaggaaagaggagcttgcacaaagccagcatgctcaggaa
caagagtttgttcagaaacaacagcaagaattagatggctctctgaaaaagatcatccag
cagcagaaggcagagttagctaatattgagagagagtgcctgaataacaagcaacagctc
atgagagctcgagaagctgcaatttgggagctcgaagaacgacacttacaagaaaaacac
cagctgctcaaacagcagcttaaagatcagtatttcatgcaaagacatcagctacttaag
cgccacgagaaggaaacagagcaaatgcagcgttacaatcaaagacttattgaggaattg
aaaaacagacagactcaagaaagagcaagactgcccaagattcagcgcagtgaagccaag
actcgaatggccatgtttaagaagagtttgagaattaactcaacagccacaccagatcag
gaccgtgataaaattaaacagtttgctgcacaagaagaaaagaggcagaaaaatgagaga
atggctcagcatcagaaacatgagaatcaaatgcgagatcttcagttgcagtgtgaagcc
aatgtccgcgaactgcatcagctgcagaatgaaaaatgccacttgttggttgagcatgag
actcagaaactgaaggagttagatgaggaacatagccaagaattaaaggagtggagagag
aaattgagacctaggaaaaagacactggaagaagagtttgccaggaaactacaggaacag
gaagtattctttaaaatgactggggagtctgaatgccttaacccatcaacacagagccgg
atttccaaattttatcctattcccagcttgcattccaccggatcataa

DBGET integrated database retrieval system