KEGG   Homo sapiens (human): 9755Help
Entry
9755              CDS       T01001                                 

Gene name
TBKBP1, ProSAPiP2, SINTBAD
Definition
TBK1 binding protein 1
Orthology
K12652  
TANK-binding kinase 1-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.32
AA seq 615 aa AA seqDB search
MESMFEDDISILTQEALGPSEVWLDSPGDPSLGGDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKDGSLLEVEKVSLQQRLNQFQHELQKN
KEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGLEQQLRQQQGLQDAAF
SNLSPPPAPAPPCTDLDLHYLALRGGSGLSHAGWPGSTPSVSDLERRRLEEALEAAQGEA
RGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTE
LTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSPSPPARAAPPC
PPCQSPVPQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPSCQSPSPQRRSPVPPS
CPAPQPRPPPPPPPGERTLAERAYAKPPSHHVKAGFQGRRSYSELAEGAAYAGASPPWLQ
AEAATLPKPRAYGSELYGPGRPLSPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTI
RCASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDD
ALIKHIDSHLENSKI
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatgttcgaggacgacatcagcatcctgacgcaggaggccctggggcctagt
gaggtgtggctggacagtcccggagacccctcgcttgggggcgacatgtgctccgcctcc
cactttgccctcatcactgcttacggagacatcaaggaacggctggggggcctggagagg
gagaacgccaccctccgacgccgcctcaaagtctacgagatcaagtacccactgatcagt
gactttggagaggagcatggcttttctctgtatgaaatcaaggatggctccctgctggag
gtggagaaggtcagcctgcagcaacggctcaaccagttccagcatgagttacagaagaac
aaggagcaggaagaacagcttggagagatgatccaggcctacgagaaactctgcgtggag
aagagtgacttggagacagagctgagggagatgagggccctggtggagacgcacctgcgt
cagatctgtggtttggagcagcagctgcggcaacagcaaggcctccaggatgcagccttc
tccaacctgagcccaccgccagcccccgcccctccctgcactgatttagacctgcactac
ctggcactgagagggggatctggcttgagtcatgcaggctggccgggctccacacccagt
gtgagtgacctggagcggcggcggctagaagaggctttggaggccgcgcagggagaggcc
cggggggctcagctccgggaggagcagctccaggccgagtgcgagcggctgcagggggag
ctgaagcagctgcaggagacccgggcccaggatctggcctccaaccagtcggagcgagac
atggcgtgggtgaaaagagttggggatgatcaggtgaatttggcgctggcctacaccgag
ctgacggaggagctgggccggcttcgggagttgagttccctacaggggagaatcttgagg
actctgttgcaggaacaggcccggagtggcggccagaggcactcgccgctgtcacaacgc
cactccccggccccccagtgcccctccccctccccgcctgcccgagcggctcccccgtgc
cccccgtgccagtcccccgtcccccagcgccgctctcccgtgcccccgtgcccctcgccg
cagcagcgccgctctccggcctcaccctcctgcccgtcgcccgtcccgcagcgccgctcg
ccggtgccgccgtcgtgccagtcccccagcccgcagcgccgttccccggtgccccccagc
tgcccggccccgcagccccggccaccgccgccgcccccgccgggcgagaggacgctggcc
gagcgcgcctacgccaagccgcccagccaccacgtgaaggccggcttccagggccgccgc
agctactctgagctggcggagggcgcggcctacgcgggcgcctccccgccctggctgcag
gccgaagcggccactctccccaagccccgggcctacggcagcgagctctacggccctggc
aggcccctcagcccgcggcgcgccttcgagggcatccggctgcgcttcgagaagcagccg
tcggaggaggacgagtgggctgtgcccaccagcccgcccagcccggaggtgggcaccatc
cgctgcgcctccttctgcgcgggcttccccatccccgagtcgcccgccgccaccgcctac
gcccacgccgagcacgcgcagtcctggccgtccatcaacttgctgatggagacggtgggc
tccgacatccgcagctgccccctctgccagctgggtttccctgtcgggtacccggatgat
gccctcatcaaacacattgactcccacctggagaacagcaagatctag

DBGET integrated database retrieval system