KEGG   Homo sapiens (human): 976Help
Entry
976               CDS       T01001                                 

Gene name
ADGRE5, CD97, TM7LN1
Definition
(RefSeq) adhesion G protein-coupled receptor E5
  KO
K08446  
CD97 antigen
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   976 (ADGRE5)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   EMR1
    976 (ADGRE5)
Cellular antigens [BR:hsa04090]
 Proteins
  976 (ADGRE5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 835 aa AA seqDB search
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDEC
QQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNN
VGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPG
WKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTEL
TLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDP
PAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHY
DVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAG
IENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGY
GVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQ
KFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGA
FLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgggaggccgcgtctttctcgcattctgtgtctggctgactctgccgggagctgaaacc
caggactccaggggctgtgcccggtggtgccctcagaactcctcgtgtgtcaatgccacc
gcctgtcgctgcaatccagggttcagctctttttctgagatcatcaccaccccgacggag
acttgtgacgacatcaacgagtgtgcaacaccgtcgaaagtgtcatgcggaaaattctcg
gactgctggaacacagaggggagctacgactgcgtgtgcagcccgggatatgagcctgtt
tctggggcaaaaacattcaagaatgagagcgagaacacctgtcaagatgtggacgaatgt
cagcagaacccaaggctctgtaaaagctacggcacctgcgtcaacacccttggcagctat
acctgccagtgcctgcctggcttcaagttcatacctgaggatccgaaggtctgcacagat
gtgaatgaatgcacctccggacaaaacccgtgccacagctccacccactgcctcaacaac
gtgggcagctatcagtgccgctgccgcccgggctggcaaccgattccggggtcccccaat
ggcccaaacaataccgtctgtgaagatgtggacgagtgcagctccgggcagcatcagtgt
gacagctccaccgtctgcttcaacaccgtgggttcatacagctgccgctgccgcccaggc
tggaagcccagacacggaatcccgaataaccaaaaggacactgtctgtgaagatatgact
ttctccacctggaccccgccccctggagtccacagccagacgctttcccgattcttcgac
aaagtccaggacctgggcagagactccaagacaagctcagccgaggtcaccatccagaat
gtcatcaaattggtggatgaactgatggaagctcctggagacgtagaggccctggcgcca
cctgtccggcacctcatagccacccagctgctctcaaaccttgaagatatcatgaggatc
ctggccaagagcctgcctaaaggccccttcacctacatttccccttcgaacacagagctg
accctgatgatccaggagcggggggacaagaacgtcactatgggtcagagcagcgcacgc
atgaagctgaattgggctgtggcagctggagccgaggatccaggccccgccgtggcgggc
atcctctccatccagaacatgacgacattgctggccaatgcctccttgaacctgcattcc
aagaagcaagccgaactggaggagatatatgaaagcagcatccgtggtgtccaactcaga
cgcctctctgccgtcaactccatctttctgagccacaacaacaccaaggaactcaactcc
cccatccttttcgccttctcccaccttgagtcctccgatggggaggcgggaagagaccct
cctgccaaggacgtgatgcctgggccacggcaggagctgctctgtgccttctggaagagt
gacagcgacaggggagggcactgggccaccgagggctgccaggtgctgggcagcaagaac
ggcagcaccacctgccaatgcagccacctgagcagctttgcgatccttatggctcattat
gacgtggaggactggaagctgaccctgatcaccagggtgggactggcgctgtcactcttc
tgcctgctgctgtgcatcctcactttcctgctggtgcggcccatccagggctcgcgcacc
accatacacctgcacctctgcatctgcctcttcgtgggctccaccatcttcctggccggc
atcgagaacgaaggcggccaggtggggctgcgctgccgcctggtggccgggctgctgcac
tactgtttcctggccgccttctgctggatgagcctcgaaggcctggagctctactttctt
gtggtgcgcgtgttccaaggccagggcctgagtacgcgctggctctgcctgatcggctat
ggcgtgcccctgctcatcgtgggcgtctcggctgccatctacagcaagggctacggccgc
cccagatactgctggttggactttgagcagggcttcctctggagcttcttgggacctgtg
accttcatcattttgtgcaatgctgtcattttcgtgactaccgtctggaagctcactcag
aagttttctgaaatcaatccagacatgaagaaattaaagaaggcgagggcgctgaccatc
acggccatcgcgcagctcttcctgttgggctgcacctgggtctttggcctgttcatcttc
gacgatcggagcttggtgctgacctatgtgtttaccatcctcaactgcctgcagggcgcc
ttcctctacctgctgcactgcctgctcaacaagaaggttcgggaagaataccggaagtgg
gcctgcctagttgctggggggagcaagtactcagaattcacctccaccacgtctggcact
ggccacaatcagacccgggccctcagggcatcagagtccggcatatga

DBGET integrated database retrieval system