KEGG   Homo sapiens (human): 9775Help
Entry
9775              CDS       T01001                                 

Gene name
EIF4A3, DDX48, MUK34, NMP265, NUK34, RCPS, eIF4AIII
Definition
(RefSeq) eukaryotic translation initiation factor 4A3 (EC:3.6.4.13)
  KO
K13025  
ATP-dependent RNA helicase [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9775 (EIF4A3)
  Translation
   03013 RNA transport
    9775 (EIF4A3)
   03015 mRNA surveillance pathway
    9775 (EIF4A3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9775 (EIF4A3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     9775 (EIF4A3)
   mRNA cycle factors
    Stress granule specific factors
     9775 (EIF4A3)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    9775 (EIF4A3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Helicases
    9775 (EIF4A3)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    9775 (EIF4A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 411 aa AA seqDB search
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEK
PSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAV
QIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRA
IKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRIL
VKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNREL
YIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccacggccacgatggcgacctcgggctcggcgcgaaagcggctgctcaaagag
gaagacatgactaaagtggaattcgagaccagcgaggaggtggatgtgacccccacgttc
gacaccatgggcctgcgggaggacctgctgcggggcatctacgcttacggttttgaaaaa
ccatcagcaatccagcaacgagcaatcaagcagatcatcaaagggagagatgtcatcgca
cagtctcagtccggcacaggaaaaacagccaccttcagtatctcagtcctccagtgtttg
gatattcaggttcgtgaaactcaagctttgatcttggctcccacaagagagttggctgtg
cagatccagaaggggctgcttgctctcggtgactacatgaatgtccagtgccatgcctgc
attggaggcaccaatgttggcgaggacatcaggaagctggattacggacagcatgttgtc
gcgggcactccagggcgtgtttttgatatgattcgtcgcagaagcctaaggacacgtgct
atcaaaatgttggttttggatgaagctgatgaaatgttgaataaaggtttcaaagagcag
atttacgatgtatacaggtacctgcctccagccacacaggtggttctcatcagtgccacg
ctgccacacgagattctggagatgaccaacaagttcatgaccgacccaatccgcatcttg
gtgaaacgtgatgaattgactctggaaggcatcaagcaatttttcgtggcagtggagagg
gaagagtggaaatttgacactctgtgtgacctctacgacacactgaccatcactcaggcg
gtcatcttctgcaacaccaaaagaaaggtggactggctgacggagaaaatgagggaagcc
aacttcactgtatcctcaatgcatggagacatgccccagaaagagcgggagtccatcatg
aaggagttccggtcgggcgccagccgagtgcttatttctacagatgtctgggccaggggg
ttggatgtccctcaggtgtccctcatcattaactatgatctccctaataacagagaattg
tacatacacagaattgggagatcaggtcgatacggccggaagggtgtggccattaacttt
gtaaagaatgacgacatccgcatcctcagagatatcgagcagtactattccactcagatt
gatgagatgccgatgaacgttgctgatcttatctga

DBGET integrated database retrieval system