KEGG   Homo sapiens (human): 9776Help
Entry
9776              CDS       T01001                                 

Gene name
ATG13, KIAA0652, PARATARG8
Definition
autophagy related 13
Orthology
K08331  
autophagy-related protein 13
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    9776 (ATG13)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9776 (ATG13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.2
AA seq 517 aa AA seqDB search
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPE
VTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNR
LSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPV
GTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGV
IYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQ
LMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRA
SPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETE
SPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS
IDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgatctcaattcccaggacagaaaggacctggacaagtttattaaatttttt
gccctcaagactgtccaagtgattgtccaggctcggcttggtgaaaagatttgcactcgt
tcatcatcttctccaacgggttcagattggttcaacttagcaatcaaagacatcccagag
gttacacatgaagcaaagaaggcactggcaggacagctgcctgcagtcgggaggtccatg
tgtgtggagatttcacttaagacttctgagggagattccatggagctggaaatatggtgt
cttgaaatgaatgaaaagtgtgataaagaaatcaaagtttcctacacggtgtacaacaga
ctgtcattgctgctgaagtcccttcttgctataactagggtgacaccagcctataggctc
tccaggaaacaagggcatgaatatgtcatattatacaggatatattttggagaagttcag
ctgagtggcttaggagaaggcttccagacagttcgtgttgggacagtgggcacccctgtg
ggcaccatcactctttcttgtgcttacagaattaacttggcattcatgtctaccaggcaa
tttgagaggaccccacctatcatggggattattattgatcactttgtggaccgtccctat
cccagctcctctcccatgcacccctgcaattacagaactgctggtgaggacactggagta
atatacccgtctgtagaagactctcaagaagtgtgtaccacctctttttccacctcccca
ccatcccagctctcaagctctcgcctttcctatcagcctgctgccctgggcgttggatca
gctgacctggcttatccagtagtgtttgctgctggcttaaatgctacacaccctcaccag
ctgatggttcctgggaaggaaggtggggtaccccttgctcccaaccagcctgtccatggt
acccaggctgaccaggagagactggcaacctgcaccccttctgacagaacccactgtgct
gccacaccctccagtagtgaggatactgaaaccgtatcaaacagcagtgagggacgggcc
tcccctcacgatgtcttggagaccatctttgtccgaaaagtgggggcttttgtcaacaaa
cccattaaccaggtgaccctgacgagtttggatataccctttgccatgtttgctcccaag
aatttggagctggaggataccgatccaatggtgaatcctccagattccccagagactgaa
tctcctctccagggcagcctgcactcagatggctccagcgggggcagcagtggcaatacc
catgatgactttgttatgatagactttaaaccagctttttctaaagatgacattcttccg
atggacctggggaccttctatcgggagtttcagaacccacctcagctgagcagcctctcc
atagatattggagcacagtccatggctgaagacttggactcattaccagagaagctggct
gtgcatgagaagaatgtccgcgagtttgatgcctttgtggaaaccctgcagtaa

DBGET integrated database retrieval system