KEGG   Homo sapiens (human): 9777Help
Entry
9777              CDS       T01001                                 

Gene name
TM9SF4, dJ836N17.2
Definition
(RefSeq) transmembrane 9 superfamily member 4
  KO
K17086  
transmembrane 9 superfamily member 2/4
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9777 (TM9SF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.21
AA seq 642 aa AA seqDB search
MATAMDWLPWSLLLFSLMCETSAFYVPGVAPINFHQNDPVEIKAVKLTSSRTQLPYEYYS
LPFCQPSKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQSNKPVTLTVEQSRL
VAERITEDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLH
NHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSCTLPEGTNSSPQEI
DPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHWFSIINSVVVVFFLSGILSMI
IIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGSGIQLFCMILI
VIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLY
PGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNP
VRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLV
FIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFI
PSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcgatggattggttgccgtggtctttactgcttttctccctgatgtgtgaa
acaagcgccttctatgtgcctggggtcgcgcctatcaacttccaccagaacgatcccgta
gaaatcaaggctgtgaagctcaccagctctcgaacccagctaccttatgaatactattca
ctgcccttctgccagcccagcaagataacctacaaggcagagaatctgggagaggtgctg
agaggggaccggattgtcaacacccctttccaggttctcatgaacagcgagaagaagtgt
gaagttctgtgcagccagtccaacaagccagtgaccctgacagtggagcagagccgactc
gtggccgagcggatcacagaagactactacgtccacctcattgctgacaacctgcctgtg
gccacccggctggagctctactccaaccgagacagcgatgacaagaagaaggaaaaagat
gtgcagtttgaacacggctaccggctcggcttcacagatgtcaacaagatctacctgcac
aaccacctctcattcatcctttactatcatcgggaggacatggaagaggaccaggagcac
acgtaccgtgtcgtccgcttcgaggtgattccccagagcatcaggctggaggacctcaaa
gcagatgagaagagttcgtgcactctgcctgagggtaccaactcctcgccccaagaaatt
gaccccaccaaggagaatcagctgtacttcacctactctgtccactgggaggaaagtgat
atcaaatgggcctctcgctgggacacttacctgaccatgagtgacgtccagatccactgg
ttttctatcattaactccgttgttgtggtcttcttcctgtcaggtatcctgagcatgatt
atcattcggaccctccggaaggacattgccaactacaacaaggaggatgacattgaagac
accatggaggagtctgggtggaagttggtgcacggcgacgtcttcaggcccccccagtac
cccatgatcctcagctccctgctgggctcaggcattcagctgttctgtatgatcctcatc
gtcatctttgtagccatgcttgggatgctgtcgccctccagccggggagctctcatgacc
acagcctgcttcctcttcatgttcatgggggtgtttggcggattttctgctggccgtctg
taccgcactttaaaaggccatcggtggaagaaaggagccttctgtacggcaactctgtac
cctggtgtggtttttggcatctgcttcgtattgaattgcttcatttggggaaagcactca
tcaggagcggtgccctttcccaccatggtggctctgctgtgcatgtggttcgggatctcc
ctgcccctcgtctacttgggctactacttcggcttccgaaagcagccatatgacaaccct
gtgcgcaccaaccagattccccggcagatccccgagcagcggtggtacatgaaccgattt
gtgggcatcctcatggctgggatcttgcccttcggcgccatgttcatcgagctcttcttc
atcttcagtgctatctgggagaatcagttctattacctctttggcttcctgttccttgtt
ttcatcatcctggtggtatcctgttcacaaatcagcatcgtcatggtgtacttccagctg
tgtgcagaggattaccgctggtggtggagaaatttcctagtctccgggggctctgcattc
tacgtcctggtttatgccatcttttatttcgttaacaagctggacatcgtggagttcatc
ccctctctcctctactttggctacacggccctcatggtcttgtccttctggctgctaacg
ggtaccatcggcttctatgcagcctacatgtttgttcgcaagatctatgctgctgtgaag
atagactga

DBGET integrated database retrieval system