KEGG   Homo sapiens (human): 9782Help
Entry
9782              CDS       T01001                                 

Gene name
MATR3, ALS21, MPD2, VCPDM
Definition
(RefSeq) matrin 3
  KO
K13213  
matrin 3
Organism
hsa  Homo sapiens (human)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00594  
Distal myopathy
Brite
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    9782 (MATR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P43243(Tbio)
UniProt: 
Position
5q31.2
AA seq 847 aa AA seqDB search
MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGM
SSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSAR
DLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEE
KRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDDSFFGETS
HNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPV
HSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTNPAPGILGPPP
PSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE
PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKP
EGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEME
TREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPD
GKESPSDKKSKTDGSQKTESSTEGKEQEEKSGEDGEKDTKDDQTEQEPNMLLESEDELLV
DEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDGSASAAAKKKLKKVDKI
EELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENKDDYTIPDEYR
IGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE
RRQKKET
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagtcattccagcagtcatctctcagtagggactcacagggtcatgggcgtgac
ctgtctgcggcaggaataggccttcttgctgctgctacccagtctttaagtatgccagca
tctcttggaaggatgaaccagggtactgcacgccttgctagtttaatgaatcttggaatg
agttcttcattgaatcaacaaggagctcatagtgcactgtcttctgctagtacttcttcc
cataatttgcagtctatatttaacattggaagtagaggtccactccctttatcttctcaa
caccgtggagatgcagaccaggccagtaacattttggccagctttggtctgtctgctaga
gacttagatgaactgagtcgttatccagaggacaagattactcctgagaatttgccccaa
atccttctacagcttaaaaggaggagaactgaagaaggccctaccttgagttatggtaga
gatggcagatctgctacacgggagccaccatacagagtacctagggatgattgggaagaa
aaaaggcactttagaagagatagttttgatgatcgtggtcctagtctcaacccagtgctt
gattatgaccatggaagtcgttctcaagaatctggttattatgacagaatggattatgaa
gatgacagattaagagatggagaaaggtgtagggatgattctttttttggtgagacctcg
cataactatcataaatttgacagtgagtatgagagaatgggacgtggtcctggcccctta
caagagagatctctctttgagaaaaagagaggcgctcctccaagtagcaatattgaagac
ttccatggactcttaccgaagggttatccccatctgtgctctatatgtgatttgccagtt
cattctaataaggagtggagtcaacatatcaatggagcaagtcacagtcgtcgatgccag
cttcttcttgaaatctacccagaatggaatcctgacaatgatacaggacacacaatgggt
gatccattcatgttgcagcagtctacaaatccagcaccaggaattctgggacctccacct
ccctcatttcatcttgggggaccagcagttggaccaagaggaaatctgggtgctggaaat
ggaaacctgcaaggacctagacacatgcagaaaggcagagtggaaactagcagagttgtt
cacatcatggattttcaacgagggaaaaacttgagataccagctattacagctggtagaa
ccatttggagtcatttcaaatcatctgattctaaataaaattaatgaggcatttattgaa
atggcaaccacagaggatgctcaggccgcagtggattattacacaaccacaccagcgtta
gtatttggcaagccagtgagagttcatttatcccagaagtataaaagaataaagaaacct
gaaggaaagccagatcagaagtttgatcaaaagcaagagcttggacgtgtgatacatctc
agcaatttgccgcattctggctattctgatagtgctgttctcaagcttgctgagccttat
gggaaaataaagaattacatattgatgaggatgaaaagtcaggcttttattgagatggag
acaagagaagatgcaatggcaatggttgaccattgtttgaaaaaagccctttggtttcag
gggagatgtgtgaaggttgacctgtctgagaaatataaaaaactggttctgaggattcca
aacagaggcattgatttactgaaaaaagataaatcccgaaaaagatcttactctccagat
ggcaaagaatctccaagtgataagaaatccaaaactgatggttcccagaagactgagagt
tcaaccgaaggtaaagaacaagaagagaagtccggtgaagatggtgagaaagacacaaag
gatgaccagacagagcaggaacctaatatgcttcttgaatctgaagatgagctacttgta
gatgaagaagaagcagcagcactgctagaaagtggcagttcagtgggagacgagaccgat
cttgctaatttaggtgatgtggcttctgatgggaaaaaggaaccatcagataaagctgtg
aaaaaagatggaagtgcttcagcagcagcaaagaaaaagcttaaaaaggtggacaagatc
gaggaacttgatcaagaaaacgaagcagcgttggaaaatggaattaaaaatgaggaaaac
acagaaccaggtgctgaatcttctgagaacgctgatgatcccaacaaagatacaagtgaa
aacgcagatggtcaaagtgatgagaacaaggacgactatacaatcccagatgagtataga
attggaccatatcagcccaatgttcctgttggtatagactatgtgatacctaaaacaggg
ttttactgtaagctgtgttcactcttttatacaaatgaagaagttgcaaagaatactcat
tgcagcagccttcctcattatcagaaattaaagaaatttctgaataaattggcagaagaa
cgcagacagaagaaggaaacttaa

DBGET integrated database retrieval system