KEGG   Homo sapiens (human): 9785Help
Entry
9785              CDS       T01001                                 

Gene name
DHX38, DDX38, PRP16, PRPF16
Definition
DEAH (Asp-Glu-Ala-His) box polypeptide 38 (EC:3.6.4.13)
Orthology
K12815  
pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9785 (DHX38)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9785 (DHX38)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Step II factors
    9785 (DHX38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22
AA seq 1227 aa AA seqDB search
MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRR
EREEKDDGEDKKKSKVSSYKDWEESKDDQKDAEEEGGDQAGQNIRKDRHYRSARVETPSH
PGGVSEEFWERSRQRERERREHGVYASSKEEKDWKKEKSRDRDYDRKRDRDERDRSRHSS
RSERDGGSERSSRRNEPESPRHRPKDAATPSRSTWEEEDSGYGSSRRSQWESPSPTPSYR
DSERSHRLSTRDRDRSVRGKYSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREEG
EEGISFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQ
KRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGR
IVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMG
VKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQE
LLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSEE
MGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSLN
TDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQ
EDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEELENAPALAVLPIYS
QLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDAL
QIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKS
LGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLI
VSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKN
NNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQ
AAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEW
LAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVR
STKIYTPGRKEQGEPMTPRRTPARFGL
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaccagtgaggatgcctcgatccatcgattggaaggcactgatctggactgt
caggttggtggtcttatttgcaagtccaaaagtgcggccagcgagcagcatgtcttcaag
gctcctgctccccgcccttcattactcggactggacttgctggcttccctgaaacggaga
gagcgagaggagaaggacgatggggaggacaagaagaagtccaaagtctcctcctacaag
gactgggaagagagcaaggatgaccagaaggatgctgaggaagagggcggtgaccaggct
ggccaaaatatccggaaagacagacattatcggtctgctcgggtagagactccatcccat
ccgggtggtgtgagcgaagagttttgggaacgcagtcggcagagagagcgggagcggcgg
gaacatggtgtctatgcctcgtccaaagaagaaaaggattggaagaaggagaaatcgcgg
gatcgagactatgaccgcaagagggacagagatgagcgggatagaagtaggcacagcagc
agatcagagcgagatggagggtcagagcgtagcagcagaagaaatgaacccgagagccca
cgacatcgacctaaagatgcagccaccccttcaaggtctacctgggaggaagaggacagt
ggctatggctcctcaaggcgctcacagtgggaatcgccctccccgacgccttcctatcgg
gattctgagcggagccatcggctgtccactcgagatcgagacaggtctgtgaggggcaag
tactcggatgacacgcctctgccaactccctcctacaaatataacgagtgggccgatgac
agaagacacttggggtccaccccgcgtctgtccaggggccgaggaagacgtgaggagggc
gaagaaggaatttcatttgacacggaggaggagcggcagcagtgggaagatgaccagagg
caagccgatcgggattggtacatgatggacgagggctatgacgagttccacaacccgctg
gcctactcctccgaggactacgtgaggaggcgggagcagcacctgcataaacagaagcag
aagcgcatttcagctcagcggagacagatcaatgaggataacgagcgctgggagacaaac
cgcatgctcaccagtggggtggtccatcggctggaggtggatgaggactttgaagaggac
aacgcggccaaggtgcatctgatggtgcacaatctggtgcctccctttctggatgggcgc
attgtcttcaccaagcagccggagccggtgattccagtgaaggatgctacttctgacctg
gccatcattgctcggaaaggcagccagacagtgcggaagcacagggagcagaaggagcgc
aagaaggctcagcacaaacactgggaactggcggggaccaaactgggagatataatgggc
gtcaagaaggaggaagagccagataaagctgtgacggaggatgggaaggtggactacagg
acagagcagaagtttgcagatcacatgaagagaaagagcgaagccagcagtgaatttgca
aagaagaagtccatcctggagcagaggcagtacctgcccatctttgcagtgcagcaggag
ctgctcactattatcagagacaacagcatcgtgatcgtggttggggagacggggagtggt
aagaccactcagctgacgcagtacctgcatgaagatggttacacggactatgggatgatt
gggtgtacccagccccggcgtgtagctgccatgtcagtggccaagagagtcagtgaagag
atggggggaaaccttggcgaggaggtgggctatgccatccgctttgaagactgcacttca
gagaacaccttgatcaaatacatgactgacgggatcctgctccgagagtccctccgggaa
gccgacctggatcactacagtgccatcatcatggacgaggcccacgagcgctccctcaac
actgacgtgctctttgggctgctccgggaggtagtggctcggcgctcagacctgaagctc
atcgtcacatcagccacgatggatgcggagaagtttgctgccttttttgggaatgtcccc
atcttccacatccctggccgtaccttccctgttgacatcctcttcagcaagaccccacag
gaggattacgtggaggctgcagtgaagcagtccttgcaggtgcacctgtcgggggcccct
ggagacatccttatcttcatgcctggccaagaggacattgaggtgacctcagaccagatt
gtggagcatctggaggaactggagaacgcgcctgccctggctgtgctgcccatctactct
cagctgccttctgacctccaggccaaaatcttccagaaggctccagatggcgttcggaag
tgcatcgttgccaccaatattgccgagacgtctctcactgttgacggcatcatgtttgtt
atcgattctggttattgcaaattaaaggtcttcaaccccaggattggcatggatgctctg
cagatctatcccattagccaggccaatgccaaccagcggtcagggcgagccggcaggacg
ggcccaggtcagtgtttcaggctctacacccagagcgcctacaagaatgagctcctgacc
accacagtgcccgagatccagaggactaacctggccaacgtggtgctgctgctcaagtcc
ctcggggtgcaggacctgctgcagttccacttcatggacccgcccccggaggacaacatg
ctcaactctatgtatcagctctggatcctcggggccctggacaacacaggtggtctgacc
tctaccgggcggctgatggtggagttcccgctggaccctgccctgtccaagatgctcatc
gtgtcctgtgacatgggctgcagctccgagatcctgctcatcgtttccatgctctcggtc
ccagccatcttctacaggcccaagggtcgagaggaggagagtgatcaaatccgggagaag
ttcgctgttcctgagagcgatcatttgacctacctgaatgtttacctgcagtggaagaac
aataattactccaccatctggtgtaacgatcatttcatccatgctaaggccatgcggaag
gtccgggaggtgcgagctcaactcaaggacatcatggtgcagcagcggatgagcctggcc
tcgtgtggcactgactgggacatcgtcaggaagtgcatctgtgctgcctatttccaccaa
gcagccaagctcaagggaatcggggagtacgtgaacatccgcacagggatgccctgccac
ttgcaccccaccagctccctttttggaatgggctacaccccagattacatagtgtatcac
gagttggtcatgaccaccaaggagtatatgcagtgtgtgaccgctgtggacggggagtgg
ctggcggagctgggccccatgttctatagcgtgaaacaggcgggcaagtcacggcaggag
aaccgtcgtcgggccaaagaggaagcctctgccatggaggaggagatggcgctggccgag
gagcagctgcgagcccggcggcaggagcaggagaagcgcagccccctgggcagtgtcagg
tctacgaagatctacactccaggccggaaagagcaaggggagcccatgacccctcgccgc
acgccagcccgctttggtctgtga

DBGET integrated database retrieval system