KEGG   Homo sapiens (human): 9789Help
Entry
9789              CDS       T01001                                 

Gene name
SPCS2
Definition
signal peptidase complex subunit 2 homolog (S. cerevisiae) (EC:3.4.-.-)
Orthology
K12947  
signal peptidase complex subunit 2 [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    9789 (SPCS2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     9789 (SPCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 226 aa AA seqDB search
MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSL
DDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVIS
YFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGR
TKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagctgtacagggcgggagaagcggtggtagcggaggctgtagtggggct
ggtggtgcttccaactgcgggacaggaagtggccgtagcggcttgttggataagtggaag
atagatgataagcctgtaaaaattgacaagtgggatggatcagctgtgaaaaactctttg
gatgattctgccaaaaaggtacttctggaaaaatacaaatatgtggagaattttggtcta
attgatggtcgcctcaccatctgtacaatctcctgtttctttgccatagtggctttgatt
tgggattatatgcacccctttccagagtccaaacccgttttggctttgtgtgtcatatcc
tattttgtgatgatggggattctgaccatttatacctcatataaggagaagagcatcttt
ctcgtggcccacaggaaagatcctacaggaatggatcctgatgatatttggcagctgtcc
tccagtcttaaaaggtttgatgacaaatacaccttgaagctgaccttcatcagtgggaga
acaaagcagcagcgggaagccgagttcacaaagtccattgctaagttttttgaccacagt
gggacactggtcatggatgcatatgagcctgaaatatccaggctccatgacagtcttgcc
atagaaagaaaaataaagtag

DBGET integrated database retrieval system