KEGG   Homo sapiens (human): 9790Help
Entry
9790              CDS       T01001                                 

Gene name
BMS1, ACC, BMS1L
Definition
(RefSeq) BMS1, ribosome biogenesis factor
  KO
K14569  
ribosome biogenesis protein BMS1
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Disease
H01896  
Aplasia cutis congenita
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    9790 (BMS1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   GTPase
    9790 (BMS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14692(Tbio)
UniProt: 
Position
10q11.21
AA seq 1282 aa AA seqDB search
MEAKDQKKHRKKNSGPKAAKKKKRLLQDLQLGDEEDARKRNPKAFAVQSAVRMARSFHRT
QDLKTKKHHIPVVDRTPLEPPPIVVVVMGPPKVGKSTLIQCLIRNFTRQKLTEIRGPVTI
VSGKKRRLTIIECGCDINMMIDLAKVADLVLMLIDASFGFEMETFEFLNICQVHGFPKIM
GVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYPGAKLFYLSGMVHGEYQNQEIHNLGRFIT
VMKFRPLTWQTSHPYILADRMEDLTNPEDIRTNIKCDRKVSLYGYLRGAHLKNKSQIHMP
GVGDFAVSDISFLPDPCALPEQQKKRCLNEKEKLVYAPLSGVGGVLYDKDAVYVDLGGSH
VFQDEVGPTHELVQSLISTHSTIDAKMASSRVTLFSDSKPLGSEDIDNQGLMMPKEEKQM
DLNTGRMRRKAIFGDEDESGDSDDEEDDEMSEDDGLENGSSDEEAEEEENAEMTDQYMAV
KGIKRRKLELEEDSEMDLPAFADSDDDLERSSAEEGEAEEADESSEEEDCTAGEKGISGS
KAAGEGSKAGLSPANCQSDRVNLEKSLLMKKAALPTFDSGHCTAEEVFASEDESEESSSL
SAEEEDSENEEAIRKKLSKPSQVSSGQKLGPQNFIDETSDIENLLKEEEDYKEENNDSKE
TSGALKWKEDLSRKAAEAFLRQQQAAPNLRKLIYGTVTEDNEEEDDDTLEELGGLFRVNQ
PDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELY
GDFEDLETGDVHKGKSGPNTQNEDIEKEVKEEIDPDEEESAKKKHLDKKRKLKEMFDAEY
DEGESTYFDDLKGEMQKQAQLNRAEFEDQDDEARVQYEGFRPGMYVRIEIENVPCEFVQN
FDPHYPIILGGLGNSEGNVGYVQMRLKKHRWYKKILKSRDPIIFSVGWRRFQTIPLYYIE
DHNGRQRLLKYTPQHMHCGAAFWGPITPQGTGFLAIQSVSGIMPDFRIAATGVVLDLDKS
IKIVKKLKLTGFPYKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEG
AFRASFEDKLLMSDIVFMRTWYPVSIPAFYNPVTSLLKPVGEKDTWSGMRTTGQLRLAHG
VRLKANKDSLYKPILRQKKHFNSLHIPKALQKALPFKNKPKTQAKAGKVPKDRRRPAVIR
EPHERKILALLDALSTVHSQKMKKAKEQRHLHNKEHFRAKQKEEEEKLKRQKDLRKKLFR
IQGQKERRNQKSSLKGAEGQLQ
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atggaggctaaggaccagaagaaacacagaaagaaaaacagtggacccaaagctgcaaag
aaaaagaagcggcttctgcaggatctccagctaggagacgaagaagatgcccggaagaga
aatcccaaagcttttgcagttcagtctgctgtgcggatggctcgatcctttcacaggact
caggatttgaagacaaaaaagcatcatattccagtggttgatcgaactccactagagccc
ccaccaatagtggtagtggtgatgggacctccaaaagttggaaagagcactttgatacaa
tgcctcattcggaactttacccggcagaagttgactgagatcagaggccctgtgacgatt
gtgtcaggtaaaaagcgcagactcaccattattgaatgtgggtgtgacattaacatgatg
attgatctggctaaagtagcagatctggtactgatgcttatagatgccagctttgggttt
gaaatggaaacgtttgagtttctaaacatctgtcaagtacatggctttcctaaaattatg
ggagttctcacccacctcgactccttcaagcataataagcaactgaagaagacaaagaag
cgattaaaacacaggttctggacggaagtttacccgggtgccaagctgttctacctttct
ggaatggtgcatggagaatatcaaaaccaagaaatccacaatctgggccgttttattaca
gttatgaagtttaggcctctcacatggcaaacttctcacccttatatcctggcagacagg
atggaagatttgacaaacccagaggatatccgaacaaacatcaaatgtgaccggaaggtg
tcactttatggttatttaagaggagcacacttgaaaaataaaagccaaattcacatgcca
ggggtaggagattttgccgtgagtgacatcagtttcctcccagacccttgcgctcttcct
gaacaacaaaagaagcgctgtttaaatgagaaggagaagctggtttatgcgcctctttct
ggagttgggggtgtgctgtatgacaaagacgctgtctatgttgaccttggtggcagccac
gtttttcaggatgaagtggggcccacccatgagctggtccagagtctcatctctacccac
tccaccattgatgccaagatggcttcaagtcgagtgacgctgttttctgattccaagcca
cttgggtcagaggatatagataatcaagggctaatgatgccaaaggaggaaaaacaaatg
gacttgaacactggtcgaatgcgtcggaaagccattttcggagatgaagatgaatctgga
gatagtgatgatgaagaagatgatgaaatgtctgaagatgacgggttggaaaacggctct
agtgatgaggaagcagaagaggaggaaaatgctgagatgactgatcagtatatggctgtt
aagggcatcaaacgacggaaacttgagttggaagaagacagtgaaatggatttgccagca
tttgctgacagtgacgatgaccttgagaggagctcagcggaagaaggggaagcggaggaa
gctgatgaaagcagtgaagaagaggactgcactgcaggagagaagggcatttcaggatca
aaggctgctggagaaggtagtaaagcagggctgtcaccagctaattgccagagtgaccgt
gtgaatctggagaagtctttgctgatgaagaaagcagctctccccactttcgattctggg
cattgcacagctgaagaggtgtttgcatctgaagatgaatctgaagaaagctcctcactc
agtgcagaggaagaagactcagaaaatgaagaggctattagaaaaaagctttcaaagcct
tctcaagtgagcagtggtcagaaactggggccacagaacttcattgatgagaccagtgat
atagaaaatttactcaaagaggaagaagattacaaggaagaaaataatgattccaaagaa
acgtcaggtgccctcaagtggaaggaagacctttccagaaaggcagctgaggcctttctg
aggcagcagcaagcagctccaaacctccgaaagcttatttatgggacagtgacagaagat
aatgaagaagaagatgatgatactctagaagagcttggagggttgtttcgtgtcaaccag
cctgacagagagtgtaagcacaaggctgactctttggactgctccagatttcttgtggag
gccccccatgactgggatttagaggaggttatgaacagtatcagagattgcttcgtgact
ggaaagtgggaagatgataaagatgcagccaaggtcttagcagaagatgaggagctctac
ggtgactttgaagacttggaaacaggggacgtgcacaagggaaaatcaggccccaatact
cagaatgaagatatagagaaagaagttaaggaagaaattgaccccgacgaagaagaaagt
gccaagaaaaagcatttggataagaagagaaaattgaaggagatgtttgatgcagaatat
gatgaaggagaaagcacatattttgatgatcttaaaggagaaatgcagaaacaagcacag
ctgaatcgcgcagaatttgaagatcaagatgatgaagccagagttcagtatgagggtttt
cgacctgggatgtacgtccgcattgagattgaaaatgttccctgtgaatttgtgcagaac
tttgacccccattaccccattatcctgggtggcttgggcaacagtgagggaaatgttggc
tacgtgcagatgcgtctgaagaaacatcgctggtataagaaaatcctcaagtcccgagat
ccaatcatattttctgtagggtggaggaggtttcagaccatcccactgtattatatcgaa
gaccacaatggaagacaaaggcttctaaagtataccccacagcacatgcattgcggagca
gccttttggggccctatcactccacagggaactggtttcttggcaatacagtctgtcagt
ggcataatgcctgattttcggatagctgctacaggagttgtccttgatctggataaatcc
ataaaaattgtgaagaaattaaagctaactggttttccatataaaattttcaagaacact
tcatttattaagggaatgtttaattctgccttggaagtggccaaatttgaaggtgctgtg
attcgaacagtcagtgggataagggggcagatcaagaaagcactccgagctccagaagga
gctttcagggccagctttgaggataagctgctgatgagcgatattgtcttcatgcgaact
tggtatcctgtttccatcccagcgttctataacccagtaacatctttgttgaaaccagtg
ggtgagaaagacacctggtcaggaatgcggaccacgggccaactcaggctcgcccatggc
gtcagactaaaggcgaacaaggactctctgtataagccaatcctgaggcaaaagaaacat
tttaattcactgcacattccaaaagccttgcagaaggccctgccatttaagaacaagccc
aagacccaagcaaaggcaggcaaggtgccaaaggacaggcggagaccggccgtcatacgc
gagcctcatgaaagaaagatccttgcactgctggatgctctgagtacggtgcatagtcag
aagatgaagaaggccaaggagcagcggcacctgcacaataaagagcacttcagagccaag
cagaaggaggaggaggagaagctgaagcggcagaaggacctcaggaagaagctcttcaga
attcaggggcagaaggaaagaagaaaccagaagtccagtttgaagggggctgagggccaa
ttgcagtga

DBGET integrated database retrieval system