KEGG   Homo sapiens (human): 9794Help
Entry
9794              CDS       T01001                                 

Gene name
MAML1, Mam-1, Mam1
Definition
mastermind-like 1 (Drosophila)
Orthology
K06061  
mastermind
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    9794 (MAML1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35
AA seq 1016 aa AA seqDB search
MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALH
QRCIQAKAKRAGKHRQPPAATAPAPAAPAPRLDAADGPEHGRPATHLHDTVKRNLDSATS
PQNGDQQNGYGDLFPGHKKTRREAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKHS
LGLDSLNKKRLADSSLHLNGGSNPSESFPLSLNKELKQEPVEDLPCMITGTVGSISQSNL
MPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKDPESSGSATQTPLAQDINIKT
EFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHTSGQPRADNPS
PNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQATP
APAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGP
YLQPSHVNLLSHQPPSNLNQNSANNQGSVLDYGNTKPLSHYKADCGQGSPGSGQSKPALM
AYLPQQLSHISHEQNSLFLMKPKPGNMPFRSLVPPGQEQNPSSVPVQAQATSVGTQPPAV
SVASSHNSSPYLSSQQQAAVMKQHQLLLDQQKQREQQQKHLQQQQFLQRQQHLLAEQEKQ
QFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNTLGPSNSSCPRVFPQAGNLMP
MGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGHAH
IPRQTNVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ
HQGMPNLSGQTPGNSNVSPFTAASSFHMQQQAHLKMSSPQFSQAVPNRPMAPMSSAAAVG
SLLPPVSAQQRTSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLHCTQA
YPVRTAGQELPFAYSGQPGGSGLSSVAGHTDLIDSLLKNRTSEEWMSDLDDLLGSQ
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcccacctgccccatggcggagttcgcgctgccgcggcacagcgcggtcatg
gagcgccttcgccggcgcatcgagctgtgccggcgccaccacagcacctgcgaggcccgc
tacgaggccgtgtcgcccgagcgcctggagctggagcgccaacacaccttcgccctgcac
cagcgctgcatccaggccaaggccaagcgcgccgggaagcacaggcagccgcccgccgcc
acggccccggcgcccgccgccccggccccgcgcctggacgccgctgacggccccgagcac
ggccgcccggccacgcatcttcatgatacagttaagaggaatcttgacagcgccacttcc
cctcagaatggcgatcaacagaatggctacggggacctctttcctgggcataagaagact
cgccgggaggcccctctgggagttgccatctcttccaatggactgcctccagcctccccc
ctcggtcagtctgacaagccttctggagccgacgccctgcagtccagtgggaagcactct
ctggggctagactctctcaacaaaaagcgtctggctgactccagccttcacttgaatgga
ggcagtaaccccagtgagtcatttcctctgagcctgaataaagaactgaagcaggagcct
gtcgaagacctgccttgcatgatcactgggactgtcggctccatatcgcaaagcaacctc
atgccagacctcaaccttaacgagcaggagtggaaggagctcatcgaggagctgaacagg
tcggtgcccgatgaagacatgaaggacctgtttaatgaggacttcgaggagaagaaggac
ccagagtcttctggctctgccacacaaacccccttggcacaggacattaatattaagacg
gaattctctccagcagcctttgagcaagaacagttaggctctccacaagtgagggccggg
tctgcagggcagacctttctggggccttcctctgcccctgtgagtacagattcccccagc
ctagggggctcccaaaccttattccacacctctggtcagccccgggcggacaatcccagt
ccaaacctgatgccggcatcagcccaggcccagaacgcacaaagagcccttgcaggtgtg
gtattgcccagtcagggcccaggaggggcctcagagctgtcctctgcccaccagctccag
cagatcgctgccaagcagaagcgcgagcagatgctccagaacccacagcaggccaccccg
gcaccagccccgggccagatgtccacatggcagcagacggggccctcccacagttcctta
gatgtcccttaccccatggagaagcctgccagcccttccagctacaagcaagacttcact
aactccaaactgctcatgatgcctagtgtgaataagagttcccctcggcccggaggcccc
tacctccagcccagccatgtgaacctgctgagtcaccagccaccgagtaacttgaatcag
aactccgcgaataaccaggggtctgtgctggactacggcaatacaaaacccctttctcat
tacaaagcggactgtgggcaaggcagcccggggtctggccagagcaagccagccctgatg
gcttatcttccccagcagctgtcccatataagtcacgagcagaactccctgtttctgatg
aagccaaagccaggaaatatgcctttccgatcactggttccacctggccaggagcagaac
ccttccagtgtccctgtgcaagcccaggctaccagtgttgggacccagccgcctgccgtg
tccgtggccagctcccacaacagctccccctatctcagcagccagcaacaggccgctgta
atgaagcagcatcagttgcttttggaccaacagaaacaaagggagcagcagcaaaagcat
ttacagcaacagcagttccttcagaggcaacagcaccttctcgcggaacaggagaagcaa
cagtttcagcgccatctgacccgcccaccaccccagtaccaagacccgacacaaggcagc
ttcccacagcaggttggacagttcacagggtcctctgctgccgtgcccggcatgaacacc
ttgggtccatccaactccagctgtcctcgagtgttccctcaggctgggaatctgatgcca
atgggccctggacatgcttcagtttcctctctccccacaaactcaggccaacaggaccgg
ggtgtggctcagttccctggctcccaaaacatgcctcagagcagcctctatggcatggct
tctggcataacccagatagttgcccagcccccgccacaggccaccaatggacatgcccac
attccacggcagaccaacgtgggccagaacacctccgtctcagctgcctatgggcagaac
tctctgggaagctctggcctctcccagcagcacaataaggggaccctgaaccctggttta
acaaagccaccggtcccaagggtgtcaccagccatgggaggccagaattcctcctggcag
catcagggaatgccgaacctcagtggccagaccccagggaacagcaacgtgagtcccttc
actgcagcctccagtttccacatgcagcagcaggcccacctgaaaatgtctagcccgcaa
ttctcccaggcagtgcccaacaggcccatggctcccatgagctcagcagctgccgtgggg
tccttgctacccccagtgagtgcacagcagaggaccagcgcccctgccccagcaccaccc
ccaacagcccctcagcagggcttgcctggcctgagcccagcagggcctgagctgggggcc
ttcagccagagccctgcctcacagatgggcggtcgggcggggctgcactgcacccaggcc
taccctgtgcggaccgcgggccaggagctgccttttgcctatagcgggcagccaggtggc
agtgggctctctagtgtggctggacacaccgatctgatcgactccctgctgaagaacagg
acttcagaggagtggatgagtgatttggacgacctgttagggtctcagtaa

DBGET integrated database retrieval system