KEGG   Homo sapiens (human): 9794Help
Entry
9794              CDS       T01001                                 

Gene name
MAML1, Mam-1, Mam1
Definition
(RefSeq) mastermind like transcriptional coactivator 1
  KO
K06061  
mastermind
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Th1 and Th2 cell differentiation
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    9794 (MAML1)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    9794 (MAML1)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    9794 (MAML1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92585(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.3
AA seq 1016 aa AA seqDB search
MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALH
QRCIQAKAKRAGKHRQPPAATAPAPAAPAPRLDAADGPEHGRPATHLHDTVKRNLDSATS
PQNGDQQNGYGDLFPGHKKTRREAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKHS
LGLDSLNKKRLADSSLHLNGGSNPSESFPLSLNKELKQEPVEDLPCMITGTVGSISQSNL
MPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKDPESSGSATQTPLAQDINIKT
EFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHTSGQPRADNPS
PNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQATP
APAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGP
YLQPSHVNLLSHQPPSNLNQNSANNQGSVLDYGNTKPLSHYKADCGQGSPGSGQSKPALM
AYLPQQLSHISHEQNSLFLMKPKPGNMPFRSLVPPGQEQNPSSVPVQAQATSVGTQPPAV
SVASSHNSSPYLSSQQQAAVMKQHQLLLDQQKQREQQQKHLQQQQFLQRQQHLLAEQEKQ
QFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNTLGPSNSSCPRVFPQAGNLMP
MGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGHAH
IPRQTNVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ
HQGMPNLSGQTPGNSNVSPFTAASSFHMQQQAHLKMSSPQFSQAVPNRPMAPMSSAAAVG
SLLPPVSAQQRTSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLHCTQA
YPVRTAGQELPFAYSGQPGGSGLSSVAGHTDLIDSLLKNRTSEEWMSDLDDLLGSQ
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcccacctgccccatggcggagttcgcgctgccgcggcacagcgcggtcatg
gagcgccttcgccggcgcatcgagctgtgccggcgccaccacagcacctgcgaggcccgc
tacgaggccgtgtcgcccgagcgcctggagctggagcgccaacacaccttcgccctgcac
cagcgctgcatccaggccaaggccaagcgcgccgggaagcacaggcagccgcccgccgcc
acggccccggcgcccgccgccccggccccgcgcctggacgccgctgacggccccgagcac
ggccgcccggccacgcatcttcatgatacagttaagaggaatcttgacagcgccacttcc
cctcagaatggcgatcaacagaatggctacggggacctctttcctgggcataagaagact
cgccgggaggcccctctgggagttgccatctcttccaatggactgcctccagcctccccc
ctcggtcagtctgacaagccttctggagccgacgccctgcagtccagtgggaagcactct
ctggggctagactctctcaacaaaaagcgtctggctgactccagccttcacttgaatgga
ggcagtaaccccagtgagtcatttcctctgagcctgaataaagaactgaagcaggagcct
gtcgaagacctgccttgcatgatcactgggactgtcggctccatatcgcaaagcaacctc
atgccagacctcaaccttaacgagcaggagtggaaggagctcatcgaggagctgaacagg
tcggtgcccgatgaagacatgaaggacctgtttaatgaggacttcgaggagaagaaggac
ccagagtcttctggctctgccacacaaacccccttggcacaggacattaatattaagacg
gaattctctccagcagcctttgagcaagaacagttaggctctccacaagtgagggccggg
tctgcagggcagacctttctggggccttcctctgcccctgtgagtacagattcccccagc
ctagggggctcccaaaccttattccacacctctggtcagccccgggcggacaatcccagt
ccaaacctgatgccggcatcagcccaggcccagaacgcacaaagagcccttgcaggtgtg
gtattgcccagtcagggcccaggaggggcctcagagctgtcctctgcccaccagctccag
cagatcgctgccaagcagaagcgcgagcagatgctccagaacccacagcaggccaccccg
gcaccagccccgggccagatgtccacatggcagcagacggggccctcccacagttcctta
gatgtcccttaccccatggagaagcctgccagcccttccagctacaagcaagacttcact
aactccaaactgctcatgatgcctagtgtgaataagagttcccctcggcccggaggcccc
tacctccagcccagccatgtgaacctgctgagtcaccagccaccgagtaacttgaatcag
aactccgcgaataaccaggggtctgtgctggactacggcaatacaaaacccctttctcat
tacaaagcggactgtgggcaaggcagcccggggtctggccagagcaagccagccctgatg
gcttatcttccccagcagctgtcccatataagtcacgagcagaactccctgtttctgatg
aagccaaagccaggaaatatgcctttccgatcactggttccacctggccaggagcagaac
ccttccagtgtccctgtgcaagcccaggctaccagtgttgggacccagccgcctgccgtg
tccgtggccagctcccacaacagctccccctatctcagcagccagcaacaggccgctgta
atgaagcagcatcagttgcttttggaccaacagaaacaaagggagcagcagcaaaagcat
ttacagcaacagcagttccttcagaggcaacagcaccttctcgcggaacaggagaagcaa
cagtttcagcgccatctgacccgcccaccaccccagtaccaagacccgacacaaggcagc
ttcccacagcaggttggacagttcacagggtcctctgctgccgtgcccggcatgaacacc
ttgggtccatccaactccagctgtcctcgagtgttccctcaggctgggaatctgatgcca
atgggccctggacatgcttcagtttcctctctccccacaaactcaggccaacaggaccgg
ggtgtggctcagttccctggctcccaaaacatgcctcagagcagcctctatggcatggct
tctggcataacccagatagttgcccagcccccgccacaggccaccaatggacatgcccac
attccacggcagaccaacgtgggccagaacacctccgtctcagctgcctatgggcagaac
tctctgggaagctctggcctctcccagcagcacaataaggggaccctgaaccctggttta
acaaagccaccggtcccaagggtgtcaccagccatgggaggccagaattcctcctggcag
catcagggaatgccgaacctcagtggccagaccccagggaacagcaacgtgagtcccttc
actgcagcctccagtttccacatgcagcagcaggcccacctgaaaatgtctagcccgcaa
ttctcccaggcagtgcccaacaggcccatggctcccatgagctcagcagctgccgtgggg
tccttgctacccccagtgagtgcacagcagaggaccagcgcccctgccccagcaccaccc
ccaacagcccctcagcagggcttgcctggcctgagcccagcagggcctgagctgggggcc
ttcagccagagccctgcctcacagatgggcggtcgggcggggctgcactgcacccaggcc
taccctgtgcggaccgcgggccaggagctgccttttgcctatagcgggcagccaggtggc
agtgggctctctagtgtggctggacacaccgatctgatcgactccctgctgaagaacagg
acttcagaggagtggatgagtgatttggacgacctgttagggtctcagtaa

DBGET integrated database retrieval system