KEGG   Homo sapiens (human): 98Help
Entry
98                CDS       T01001                                 

Gene name
ACYP2, ACYM, ACYP
Definition
acylphosphatase 2, muscle type (EC:3.6.1.7)
Orthology
K01512  
acylphosphatase [EC:3.6.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Pyruvate metabolism
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p16.2
AA seq 99 aa AA seqDB search
MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVN
SMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSIRY
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgcccagtcactcaaatccgtggactacgaggtgttcggaagagtgcagggt
gtttgcttcagaatgtatacagaagatgaagctaggaaaataggagtggttggctgggtg
aagaataccagcaaaggcaccgtgacaggccaagtgcaggggccagaagacaaagtcaat
tccatgaagtcctggctgagcaaggttggaagccctagttctcgcattgaccgcacaaac
ttttctaatgaaaaaaccatctctaagcttgaatactctaattttagtattagatactaa

DBGET integrated database retrieval system