KEGG   Homo sapiens (human): 98Help
Entry
98                CDS       T01001                                 

Gene name
ACYP2, ACYM, ACYP
Definition
(RefSeq) acylphosphatase 2
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    98 (ACYP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     98 (ACYP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acylphosphatase
Motif
Other DBs
NCBI-GeneID: 98
NCBI-ProteinID: NP_612457
OMIM: 102595
HGNC: 180
Ensembl: ENSG00000170634
Vega: OTTHUMG00000129287
Pharos: P14621(Tbio)
UniProt: P14621 A0A140VJD7
Position
2p16.2
AA seq 99 aa AA seqDB search
MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVN
SMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSIRY
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgcccagtcactcaaatccgtggactacgaggtgttcggaagagtgcagggt
gtttgcttcagaatgtatacagaagatgaagctaggaaaataggagtggttggctgggtg
aagaataccagcaaaggcaccgtgacaggccaagtgcaggggccagaagacaaagtcaat
tccatgaagtcctggctgagcaaggttggaagccctagttctcgcattgaccgcacaaac
ttttctaatgaaaaaaccatctctaagcttgaatactctaattttagtattagatactaa

DBGET integrated database retrieval system