KEGG   Homo sapiens (human): 9817Help
Entry
9817              CDS       T01001                                 

Gene name
KEAP1, INrf2, KLHL19
Definition
(RefSeq) kelch like ECH associated protein 1
  KO
K10456  
kelch-like protein 19
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9817 (KEAP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     9817 (KEAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 624 aa AA seqDB search
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagatcccaggcctagcggggctggggcctgctgccgattcctgcccctgcag
tcacagtgccctgagggggcaggggacgcggtgatgtacgcctccactgagtgcaaggcg
gaggtgacgccctcccagcatggcaaccgcaccttcagctacaccctggaggatcatacc
aagcaggcctttggcatcatgaacgagctgcggctcagccagcagctgtgtgacgtcaca
ctgcaggtcaagtaccaggatgcaccggccgcccagttcatggcccacaaggtggtgctg
gcctcatccagccctgtcttcaaggccatgttcaccaacgggctgcgggagcagggcatg
gaggtggtgtccattgagggtatccaccccaaggtcatggagcgcctcattgaattcgcc
tacacggcctccatctccatgggcgagaagtgtgtcctccacgtcatgaacggtgctgtc
atgtaccagatcgacagcgttgtccgtgcctgcagtgacttcctggtgcagcagctggac
cccagcaatgccatcggcatcgccaacttcgctgagcagattggctgtgtggagttgcac
cagcgtgcccgggagtacatctacatgcattttggggaggtggccaagcaagaggagttc
ttcaacctgtcccactgccaactggtgaccctcatcagccgggacgacctgaacgtgcgc
tgcgagtccgaggtcttccacgcctgcatcaactgggtcaagtacgactgcgaacagcga
cggttctacgtccaggcgctgctgcgggccgtgcgctgccactcgttgacgccgaacttc
ctgcagatgcagctgcagaagtgcgagatcctgcagtccgactcccgctgcaaggactac
ctggtcaagatcttcgaggagctcaccctgcacaagcccacgcaggtgatgccctgccgg
gcgcccaaggtgggccgcctgatctacaccgcgggcggctacttccgacagtcgctcagc
tacctggaggcttacaaccccagtgacggcacctggctccggttggcggacctgcaggtg
ccgcggagcggcctggccggctgcgtggtgggcgggctgttgtacgccgtgggcggcagg
aacaactcgcccgacggcaacaccgactccagcgccctggactgttacaaccccatgacc
aatcagtggtcgccctgcgcccccatgagcgtgccccgtaaccgcatcggggtgggggtc
atcgatggccacatctatgccgtcggcggctcccacggctgcatccaccacaacagtgtg
gagaggtatgagccagagcgggatgagtggcacttggtggccccaatgctgacacgaagg
atcggggtgggcgtggctgtcctcaatcgtctcctttatgccgtggggggctttgacggg
acaaaccgccttaattcagctgagtgttactacccagagaggaacgagtggcgaatgatc
acagcaatgaacaccatccgaagcggggcaggcgtctgcgtcctgcacaactgtatctat
gctgctgggggctatgatggtcaggaccagctgaacagcgtggagcgctacgatgtggaa
acagagacgtggactttcgtagcccccatgaagcaccggcgaagtgccctggggatcact
gtccaccaggggagaatctacgtccttggaggctatgatggtcacacgttcctggacagt
gtggagtgttacgacccagatacagacacctggagcgaggtgacccgaatgacatcgggc
cggagtggggtgggcgtggctgtcaccatggagccctgccggaagcagattgaccagcag
aactgtacctgttga

DBGET integrated database retrieval system