KEGG   Homo sapiens (human): 9817Help
Entry
9817              CDS       T01001                                 

Gene name
KEAP1, INrf2, KLHL19
Definition
(RefSeq) kelch like ECH associated protein 1
  KO
K10456  
kelch-like protein 19
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Pathways in cancer
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Disease
H00048  
Hepatocellular carcinoma
Drug target
Dimethyl fumarate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9817 (KEAP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9817 (KEAP1)
   05225 Hepatocellular carcinoma
    9817 (KEAP1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    9817 (KEAP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     9817 (KEAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14145(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 624 aa AA seqDB search
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagatcccaggcctagcggggctggggcctgctgccgattcctgcccctgcag
tcacagtgccctgagggggcaggggacgcggtgatgtacgcctccactgagtgcaaggcg
gaggtgacgccctcccagcatggcaaccgcaccttcagctacaccctggaggatcatacc
aagcaggcctttggcatcatgaacgagctgcggctcagccagcagctgtgtgacgtcaca
ctgcaggtcaagtaccaggatgcaccggccgcccagttcatggcccacaaggtggtgctg
gcctcatccagccctgtcttcaaggccatgttcaccaacgggctgcgggagcagggcatg
gaggtggtgtccattgagggtatccaccccaaggtcatggagcgcctcattgaattcgcc
tacacggcctccatctccatgggcgagaagtgtgtcctccacgtcatgaacggtgctgtc
atgtaccagatcgacagcgttgtccgtgcctgcagtgacttcctggtgcagcagctggac
cccagcaatgccatcggcatcgccaacttcgctgagcagattggctgtgtggagttgcac
cagcgtgcccgggagtacatctacatgcattttggggaggtggccaagcaagaggagttc
ttcaacctgtcccactgccaactggtgaccctcatcagccgggacgacctgaacgtgcgc
tgcgagtccgaggtcttccacgcctgcatcaactgggtcaagtacgactgcgaacagcga
cggttctacgtccaggcgctgctgcgggccgtgcgctgccactcgttgacgccgaacttc
ctgcagatgcagctgcagaagtgcgagatcctgcagtccgactcccgctgcaaggactac
ctggtcaagatcttcgaggagctcaccctgcacaagcccacgcaggtgatgccctgccgg
gcgcccaaggtgggccgcctgatctacaccgcgggcggctacttccgacagtcgctcagc
tacctggaggcttacaaccccagtgacggcacctggctccggttggcggacctgcaggtg
ccgcggagcggcctggccggctgcgtggtgggcgggctgttgtacgccgtgggcggcagg
aacaactcgcccgacggcaacaccgactccagcgccctggactgttacaaccccatgacc
aatcagtggtcgccctgcgcccccatgagcgtgccccgtaaccgcatcggggtgggggtc
atcgatggccacatctatgccgtcggcggctcccacggctgcatccaccacaacagtgtg
gagaggtatgagccagagcgggatgagtggcacttggtggccccaatgctgacacgaagg
atcggggtgggcgtggctgtcctcaatcgtctcctttatgccgtggggggctttgacggg
acaaaccgccttaattcagctgagtgttactacccagagaggaacgagtggcgaatgatc
acagcaatgaacaccatccgaagcggggcaggcgtctgcgtcctgcacaactgtatctat
gctgctgggggctatgatggtcaggaccagctgaacagcgtggagcgctacgatgtggaa
acagagacgtggactttcgtagcccccatgaagcaccggcgaagtgccctggggatcact
gtccaccaggggagaatctacgtccttggaggctatgatggtcacacgttcctggacagt
gtggagtgttacgacccagatacagacacctggagcgaggtgacccgaatgacatcgggc
cggagtggggtgggcgtggctgtcaccatggagccctgccggaagcagattgaccagcag
aactgtacctgttga

DBGET integrated database retrieval system