KEGG   Homo sapiens (human): 9818Help
Entry
9818              CDS       T01001                                 

Gene name
NUP58, NUP45, NUPL1, PRO2463
Definition
(RefSeq) nucleoporin 58kDa
  KO
K14307  
nucleoporin p58/p45
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    9818 (NUP58)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9818 (NUP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12.13
AA seq 599 aa AA seqDB search
MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPS
SGFGTGLFGSKPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASAT
PFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGG
SLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSK
ALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANG
IQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQY
RQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGY
RKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGP
QPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGS
LSAGFGSSSTSGFNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagggttctccttcgggtccgggactctgggctccaccaccgtggccgccggc
gggaccagcacaggcggcgttttctccttcggaacgggagcgtctagcaacccttctgtg
gggctcaattttggaaatcttggaagtacttcaactccagcaactacatctgctccttca
agtggttttggaaccgggctctttggatctaaacctgccactgggttcactctaggagga
acaaatacaggaatagcaacaactataactacaggattaactctgggaacgccagccact
acatctgcagctacaacaggcttcagtttaggattcaataaacctgcagcatctgccaca
ccatttgctctacctattacctctacctcagctagcggtctgactctttcgtctgctctg
acatcaactccagcagcatccacaggatttactctaaataatttgggtgggacaacagcc
acaactacaactgcatcaacaggcctctctttagggggagccttagctggtttgggaggt
tcacttttccagagtacaaacacaggaacatcaggacttggacagaatgctttagggttg
actttgggaactacagcagctacttcaactgcaggcaatgaaggccttggtggtatagat
ttcagtagctcctcagataaaaagagtgataaaacgggaacaagaccagaggatagtaaa
gctctgaaggatgaaaatctacctcctgtcatctgccaggatgttgaaaatctccagaaa
tttgtgaaggagcagaaacaagttcaagaagaaattagtagaatgtcttcaaaagcaatg
cttaaggtacaagaagatattaaagctctgaagcagctcctgtcgttggctgccaatgga
atacagagaaacactctcaacattgacaaattgaaaatagaaactgctcaggagttgaag
aatgctgaaatagctttaagaacccagaagacaccacctggacttcaacatgaatatgca
gctcctgctgactacttcagaatcttggttcagcaatttgaggtacagcttcagcagtac
aggcagcagattgaagaactagaaaaccatcttgccactcaagcaaataattcacatata
acccctcaagatttgtcaatggctatgcagaaaatttatcaaacatttgtagctttagcg
gcacaacttcagtctattcatgaaaatgtaaaggttctgaaagaacagtaccttggctac
aggaaaatgttcttgggagatgctgttgatgtgtttgaaacaaggcgagcagaagccaag
aagtggcagaacacacccagagttactactggacccactcctttcagcaccatgccaaac
gcagcagccgttgccatggctgcaacacttacacagcagcaacagcctgctacagggcca
cagccatctctgggagttagttttggaacgccattcggctcaggtattggcactggcttg
caatcaagtggcttaggttcttcaaaccttggaggatttggaactagctctggttttgga
tgcagcaccacaggggcctccacatttggatttggaacaacaaataaaccctcaggaagt
cttagtgcaggctttggcagctcaagtacatctgggtttaacttcagcaatcctggcatc
acggcatcagctggtttgacttttggggtgtccaatcctgcctctgcaggttttggaaca
ggaggacaactccttcagttgaagaaacctccagctggaaacaaaagaggaaaaagataa

DBGET integrated database retrieval system