KEGG   Homo sapiens (human): 9818Help
Entry
9818              CDS       T01001                                 

Gene name
NUPL1, PRO2463
Definition
nucleoporin like 1
Orthology
K14307  
nucleoporin p58/p45
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.13
AA seq 587 aa AA seqDB search
MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPS
SGFGTGLFGSKPATGFTLGGTNTGTPATTSAATTGFSLGFNKPAASATPFALPITSTSAS
GLTLSSALTSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSG
LGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVIC
QDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLK
IETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLA
TQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRKMFLGDAVDVF
ETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPF
GSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSG
FNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagggttctccttcgggtccgggactctgggctccaccaccgtggccgccggc
gggaccagcacaggcggcgttttctccttcggaacgggagcgtctagcaacccttctgtg
gggctcaattttggaaatcttggaagtacttcaactccagcaactacatctgctccttca
agtggttttggaaccgggctctttggatctaaacctgccactgggttcactctaggagga
acaaatacaggaacgccagccactacatctgcagctacaacaggcttcagtttaggattc
aataaacctgcagcatctgccacaccatttgctctacctattacctctacctcagctagc
ggtctgactctttcgtctgctctgacatcaactccagcagcatccacaggatttactcta
aataatttgggtgggacaacagccacaactacaactgcatcaacaggcctctctttaggg
ggagccttagctggtttgggaggttcacttttccagagtacaaacacaggaacatcagga
cttggacagaatgctttagggttgactttgggaactacagcagctacttcaactgcaggc
aatgaaggccttggtggtatagatttcagtagctcctcagataaaaagagtgataaaacg
ggaacaagaccagaggatagtaaagctctgaaggatgaaaatctacctcctgtcatctgc
caggatgttgaaaatctccagaaatttgtgaaggagcagaaacaagttcaagaagaaatt
agtagaatgtcttcaaaagcaatgcttaaggtacaagaagatattaaagctctgaagcag
ctcctgtcgttggctgccaatggaatacagagaaacactctcaacattgacaaattgaaa
atagaaactgctcaggagttgaagaatgctgaaatagctttaagaacccagaagacacca
cctggacttcaacatgaatatgcagctcctgctgactacttcagaatcttggttcagcaa
tttgaggtacagcttcagcagtacaggcagcagattgaagaactagaaaaccatcttgcc
actcaagcaaataattcacatataacccctcaagatttgtcaatggctatgcagaaaatt
tatcaaacatttgtagctttagcggcacaacttcagtctattcatgaaaatgtaaaggtt
ctgaaagaacagtaccttggctacaggaaaatgttcttgggagatgctgttgatgtgttt
gaaacaaggcgagcagaagccaagaagtggcagaacacacccagagttactactggaccc
actcctttcagcaccatgccaaacgcagcagccgttgccatggctgcaacacttacacag
cagcaacagcctgctacagggccacagccatctctgggagttagttttggaacgccattc
ggctcaggtattggcactggcttgcaatcaagtggcttaggttcttcaaaccttggagga
tttggaactagctctggttttggatgcagcaccacaggggcctccacatttggatttgga
acaacaaataaaccctcaggaagtcttagtgcaggctttggcagctcaagtacatctggg
tttaacttcagcaatcctggcatcacggcatcagctggtttgacttttggggtgtccaat
cctgcctctgcaggttttggaacaggaggacaactccttcagttgaagaaacctccagct
ggaaacaaaagaggaaaaagataa

DBGET integrated database retrieval system