KEGG   Homo sapiens (human): 9820Help
Entry
9820              CDS       T01001                                 

Gene name
CUL7, 3M1, KIAA0076, dJ20C7.5
Definition
cullin 7
Orthology
K10613  
cullin 7
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Disease
H00509  
3M syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9820 (CUL7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul7 complex
    Cullin
     9820 (CUL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 1782 aa AA seqDB search
MSRGFWLAEPLAGTGPHPAPVAADSRGCSSVPRRHAPSRLSVSTPSRGPGARMVGELRYR
EFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLW
MSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEEC
VGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWSAGRMIQAL
SSHDAGEGQCGEEGKAGEGLGRLRDSQDTVAGASDLIRTRTQILLSLSQQEAIEKHLDFD
SRCALLALFAQATLSEHPMSFEGIQLPQVPGRVLFSLVKRYLHVTSLLDQLNDSAAEPGA
QNTSAPEELSGERGQLELEFSMAMGTLISELVQAMRWDQASDRPRSSARSPGSIFQPQLA
DVSPGLPAAQAQPSFRRSRRFRPRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGD
EGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLG
RALPAWRWRPMTELYAVPYVLPEDEDTEECEHLTLAEWWELLFFIKKLDGPDHQEVLQIL
QENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGN
QAYPSLLEAQEDVLLLDAQAQAKDSEDAAKVEAKEPPSQSPNTPLQRLVEGYGPAGKILL
DLEQALSSEGTQENKVKPLLLQLQRQPQPFLALMQSLDTPETNRTLHLTVLRILKQLVDF
PEALLLPWHEAVDACMACLRSPNTDREVLQELIFFLHRLTSVSRDYAVVLNQLGARDAIS
KALEKHLGKLELAQELRDMVFKCEKHAHLYRKLITNILGGCIQMVLGQIEDHRRTHQPIN
IPFFDVFLRYLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYI
TLHMRRGILIRQLTLLVASEDSSYMPARVVVCGGDSTSSLHTELNSVNVMPSASRVILLE
NLTRFWPIIQIRIKRCQQGGIDTRIRGLEILGPKPTFWPVFREQLCRHTRLFYMVRAQAW
SQDMAEDRRSLLHLSSRLNGALRQEQNFADRFLPDDEAAQALGKTCWEALVSPVVQNITS
PDEDGISPLGWLLDQYLECQEAVFNPQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVVATP
RPKGRNRSHDWSSLATRGLPSSIMRNLTRCWRAVVEKQVNNFLTSSWRDDDFVPRYCEHF
NILQNSSSELFGPRAAFLLALQNGCAGALLKLPFLKAAHVSEQFARHIDQQIQGSRIGGA
QEMERLAQLQQCLQAVLIFSGLEIATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCF
PNRLPQQMLQSLSTSKELQRQFHVYQLQQLDQELLKLEDTEKKIQVGLGASGKEHKSEKE
EEAGAAAVVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPS
YLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYL
NDLKAVSVESLLAFSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRS
RWDIVRLIPPQTYLQAEGEDGQNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAW
QKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPH
TESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTATQSFSTFR
NT seq 5349 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtggcttttggctggcggagccgctggcagggaccgggccccaccctgcccca
gtggctgccgactcacgcgggtgcagctctgttccgcggaggcacgccccctcccgtctc
tccgtctcgaccccctcgcggggcccaggtgccaggatggtgggagaactccgctacagg
gaattcagggtgcccctggggcccggcttacatgcctatcctgatgagctgatccgccag
cgcgtgggccatgatgggcatcctgagtaccagatccgttggctcatcctgcggcgtggc
gatgagggggacgggggctctggccaagtggactgcaaggctgagcacatcctgctgtgg
atgtccaaggatgagatctatgccaactgccacaagatgctgggcgaggatggccaggtc
atcgggccctcccaggagtctgcaggggaggttggggccctggacaaatctgtgctggag
gagatggaaaccgacgtgaagtccctcattcagagagcccttcggcagctggaggagtgt
gtgggcactatccctcctgctcctctacttcacactgtccacgtgctcagcgcctatgcc
agcattgagcccctcactggagtattcaaggacccaagggtcctggacttgctcatgcac
atgttgagtagtcctgattatcagattcgctggagtgcaggccggatgatacaagccctg
tcctcccatgacgctggtgaggggcagtgtggggaggaagggaaagcaggagaagggctg
ggtcggctcagggactcacaggacactgtggcaggagcctctgatctcatcaggacccgg
actcagatccttctgtcactgagccaacaagaagccattgagaaacacctggattttgac
agccgctgtgctctgctagcactgtttgcacaggccacgctctctgaacaccccatgtct
ttcgagggcattcagctaccacaggtcccaggaagggtgctcttctccctggtgaagcgg
tatttgcatgtcacctcgctcctggatcagctgaacgacagtgctgcggagccaggagcc
cagaacacctctgctcctgaggagttgagtggggagaggggtcaactggagctggagttc
agtatggccatgggcaccctgatctcggagctggtgcaagccatgcgctgggaccaggcc
tcagacagaccaaggagctcagcacggtcccccggttccatcttccagcctcagctggca
gatgtgagcccagggctccccgctgcccaggctcagccctccttcaggaggtcaagacgt
tttcgccctcgttctgagttcgcaagtggcaatacctatgctttgtatgtgcgggacaca
ctgcagccggggatgcgagtgcggatgctggatgattatgaggagatcagtgccggggat
gagggcgagtttcggcagagcaacaacggtgtgcctcctgtgcaggtattttgggagtca
acaggccgcacctattgggtgcactggcacatgctggagatcttgggctttgaggaagac
attgaggacatggttgaggctgatgagtaccaaggggcagtggccagtagagtcctgggt
agagccctgcctgcctggcgctggaggcccatgacagaactctatgctgtgccttatgtg
ctgcctgaggatgaggacactgaggagtgtgaacacctgaccctggctgagtggtgggaa
ctcctcttcttcatcaagaagctggatggacctgaccatcaggaggttctccagatcctc
caggagaacctagatggggagattctggatgatgagatcctagctgaactggccgtgccc
atagaattggcccaggacttgctgctgactctgccacagcgactcaatgacagtgccctc
agggacctgatcaactgccatgtctacaagaagtatgggcctgaagccctagcagggaac
caagcctacccatcccttctagaagcccaagaagatgtcctcctgctagacgcgcaggcc
caggctaaggactcagaagatgcagccaaagtggaagcaaaagaacccccatctcagagt
cccaacactcccctgcagcgtctggtggagggttatggtccagctgggaaaatcctcctg
gatctagagcaagccctcagctcagaggggacccaggagaacaaggtcaagccactcctg
ctgcagctgcagcggcagccgcagcccttcctggcactgatgcagagcctggacactccg
gagactaacaggaccctgcacctgactgtgctgagaatcctgaagcagctggtggacttc
cccgaggcactgctgctcccctggcacgaggccgtggatgcctgcatggcctgcctgcgg
tccccaaacactgatcgagaggtgctccaggaactgattttcttcctgcaccgcctgacc
tcagtgagcagggactatgccgtggtgctgaatcagctgggagcaagagacgctatctcc
aaggccctggaaaagcacctgggaaagctggagctggctcaggagctgcgggacatggtg
ttcaagtgtgagaagcatgcccacctctaccgcaaactcatcaccaacatcctgggaggc
tgcatccagatggtgctgggccagatcgaagaccacagacgaacccaccaacccatcaac
atccctttctttgatgtgttcctcagatacctgtgccagggctccagtgtggaagtgaag
gaggacaagtgctgggagaaggtggaggtgtcctccaacccgcaccgggccagcaagctg
acggaccacaaccccaagacctattgggagtccaacggcagcgccggctcccactacatc
accctgcacatgcgccggggcatcctcatcaggcaactgactctgcttgtggctagtgag
gactcgagttacatgccggcccgagtggtggtgtgcgggggtgatagcactagctctctt
cacacggaactcaactcggtgaatgtgatgccctctgccagccgggtgatcctcctggag
aacctgacccgcttctggcccatcatccagatccgcataaagcgctgccagcagggtggc
attgatacgcgcattcgggggttagagatcctaggccccaagcccacgttctggccagtg
ttccgggagcagctctgtcgtcacacacgcctcttctacatggttcgggcacaggcctgg
agccaggacatggcagaggaccgcaggagcctcctgcacctgagttctagactcaacggt
gctctgcgccaggagcagaattttgctgaccgcttcctccctgatgacgaggctgcccaa
gctctgggcaagacctgctgggaggccctggtcagccccgtggtgcagaacatcacctcc
cctgatgaggatggcattagccccctgggttggctgctggaccagtacctggagtgtcag
gaagctgtcttcaacccccagagccgcggcccagctttcttctcgcgggtgcgccgtctc
actcacctgctggtgcatgtcgagccctgtgaggcaccccctcctgtggtggccactcct
cggcccaaaggcagaaacagaagccacgactggagctccttggctacccggggccttcca
agcagcatcatgagaaacctgacgcgctgttggcgggccgtggtggagaagcaggtgaac
aattttctgacctcatcctggcgggatgatgactttgtgccacgctactgtgagcacttt
aatattctgcagaactcaagctctgaactgtttgggcctcgggcagccttcttgctggcg
ctgcaaaatggctgtgcgggagccttgctgaagctcccttttctcaaagctgcccacgtg
agtgagcagttcgcccggcacattgaccagcagatccagggcagccggatcggtggagcc
caggaaatggagaggctggcacagctgcagcaatgcctgcaagctgtcctgattttctcc
ggcttggagatagccaccacttttgagcattattaccagcactacatggcggaccgtctc
ctgggcgtggtctcgagctggctggagggggccgtgctggagcagatcggtccctgcttc
cccaaccgcctcccccagcagatgttgcagagcctgagcacctctaaggagctgcagcgc
cagttccacgtctaccagctccagcagctggatcaggaactcctgaagctggaggataca
gagaagaaaatacaggtgggccttggggccagtggcaaggagcacaagagcgagaaggaa
gaggaagctggggcagcagcagtggtggatgtggcggagggagaggaggaagaggaggag
aatgaggacctctactatgaaggggcaatgccagaagtgtctgtgcttgtcctgtcccga
cactcctggcctgttgcctcaatctgccacacactgaaccccagaacctgcctgccctcc
tacctgaggggcactttgaacagatactccaacttctacaacaagagtcagagccaccct
gcccttgagcgaggctcacagaggcgactgcagtggacgtggctgggctgggctgagctg
cagtttgggaaccagaccctgcatgtgtccaccgtgcagatgtggctactgctgtatctc
aacgacctgaaggcggtctctgtggagagtctgctggcgttctcagggctctccgcagac
atgctcaatcaggcgattgggcccctcacctcttcaagaggccccctggaccttcacgag
caaaaggatataccaggaggggtcctcaagattcgagatggcagcaaggaacccaggtcg
agatgggacattgtgcggctcatcccacctcagacgtacctgcaagctgagggtgaagac
ggccagaacttggagaagagacggaatcttctgaactgcctcatcgtccgaatcctcaag
gcccatggagatgaggggctgcacattgaccagcttgtctgtctggtgctggaggcttgg
cagaagggcccgtgtcctcccaggggtttggtcagcagccttggtaaggggtctgcatgc
agcagcactgacgtcctctcctgcatcctacacctcctgggcaagggcacgctgagacgc
catgacgaccggccccaggtgctgtcctatgcagtccctgtgactgtcatggagcctcac
actgagtccctgaacccaggctcctcaggccccaacccacccctcaccttccatacccta
cagattcgctcccggggtgtgccctatgcctcctgcactgccacccagagcttctctacc
ttccggtag

DBGET integrated database retrieval system