KEGG   Homo sapiens (human): 9826Help
Entry
9826              CDS       T01001                                 

Gene name
ARHGEF11, GTRAP48, PDZ-RHOGEF
Definition
Rho guanine nucleotide exchange factor (GEF) 11
Orthology
K12331  
Rho guanine nucleotide exchange factor 11
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    9826 (ARHGEF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 1522 aa AA seqDB search
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSMGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLES
DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTV
GKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFP
NLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIAL
ELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGT
SEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQ
TFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQ
GKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADS
ALEDVENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGG
EGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGY
KVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPPDSSTDHSEAP
MSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIEQLTLKLNRLK
DMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPC
PEDGSDAPLEDSTADAAASPGP
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaggttaccccagagtatagacaggttaagtagcctgtcttctctgggagat
tctgcaccagagcgcaagtccccttcccaccatcgccagccttcggatgcctctgagaca
acaggtctcgttcaacgctgtgtcattatccaaaaggaccagcatggcttcggcttcaca
gtcagtggggatcgcattgttctggtgcagtctgtgcggcctggaggtgcagccatgaag
gccggtgtgaaagagggcgaccggatcatcaaagtcaacggcaccatggtgaccaatagc
tcacacctggaagtggtaaagctgatcaaatctggcgcctatgtcgcactcaccctcctg
ggctcttcaccttcatccatgggcatctctgggctccagcaggacccatccccagcagga
gctccccgaatcacgtcagtgatcccctcaccaccacctcctccacctctaccacctcca
caacgcatcacaggacccaaacctctgcaggatcccgaagttcaaaaacatgccacccag
atcctcaggaatatgctgaggcaggaagaaaaagaattacaggacatacttccactatat
ggtgacaccagccagagaccatcagaaggccggctctctctggattcccaggagggggac
agtggcttggactctgggacagaacgctttccttccctcagtgagtcattgatgaatcgg
aactcggtactgtcagaccctgggctagacagtcctcgaacctcccctgtgatcatggcc
agggtggcccagcaccacaggcggcagggctcggatgcagcagtcccctcaaccggtgac
cagggtgtagatcaaagcccaaagcctttaattattggcccagaggaagactatgacccg
ggttatttcaacaacgagagcgacatcatattccaggatctggagaaactgaagtctcgg
ccagctcacctgggggtttttctacgttacatcttctctcaggcggaccccagtccactg
cttttttacctgtgtgcagaagtttatcagcaggcaagccccaaggattcccgaagcttg
gggaaagacatctggaatattttcctggagaaaaatgcgcctctgagagtgaagatccct
gagatgctacaggctgaaattgactcgcgcctgcggaacagcgaagatgcccgtggtgtt
ctctgtgaagctcaagaggcagccatgcctgagatccaagagcagatccacgactacaga
acgaagcgcacactggggctgggcagcctgtatggtgaaaatgacctgctggacctggat
ggggaccctctccgagagcgccaagtggctgagaagcagctggctgcccttggagatatt
ttgtccaagtatgaggaagacaggagcgcccccatggacttcgccctcaatacctacatg
agccatgctgggatccgtcttcgagaggcacgaccttccaacacagctgaaaaggcccag
tctgctcctgacaaggacaagtggctaccgttcttccctaagaccaagaagagcagcaat
tccaagaaagaaaaggatgccttggaggacaagaagcgaaaccctatcctcaaatacatt
gggaagcccaaaagctcttctcaaagcacatttcatattcccttgtcccctgtggaagtc
aaaccaggcaatgtgaggaacatcattcagcactttgagaacaaccagcagtatgatgcc
ccagaacctgggacacaacgactctcgaccggaagctttcctgaggacctgctggagagt
gacagttcacgctcagagattcgcctgggccgctctgaaagcctcaagggccgggaagag
atgaaacggtctcgaaaggcagagaacgtgccccgctctcgcagtgatgttgacatggat
gctgctgcggaggctactcgcctgcaccagtcagcctcgtcctctacctccagcctctcc
accaggtctcttgagaacccaacccctccattcactcccaaaatgggccgcaggagcatt
gagtcccccagtttggggttctgcacagataccctccttccccacctcctagaggatgat
ctgggccagctgtctgacctggagccagagccagatgcccaaaattggcagcatacagtg
ggcaaggatgtggtggctgggctaacccagcgggagattgaccggcaagaggtcatcaat
gagctgtttgtgactgaagcttcccacctgcgcacactccgggtcctggacctgatcttc
taccagcgaatgaagaaggagaacctgatgccccgggaggagctggcccggctcttcccg
aacctgcctgaactcatagagattcacaattcctggtgtgaagccatgaagaagctccgg
gaggaaggccccatcatcaaagagatcagtgacctcatgctggcccggtttgatggccct
gcccgagaggaactccagcaagtggctgcacagttctgttcctatcagtcaatagcccta
gagctaatcaagaccaagcaacgcaaggagagtcgattccagctcttcatgcaggaggct
gagagccaccctcagtgtcggcggctgcagctgagagacctcatcatctctgagatgcag
cggctcaccaagtacccgctgctgctggagagcatcatcaagcacacagagggtggcacc
tctgagcatgagaagctgtgccgggcccgggaccagtgccgggagattctcaagtatgtg
aatgaagcggtaaaacaaacagagaaccgccaccgtttagagggctaccagaaacgcctg
gatgccaccgccctggagagggccagcaaccccctggcagcagagttcaagagcctggat
cttacaaccagaaaaatgatccatgagggacccctgacctggaggatcagcaaggataag
accttggacctccacgtgctgctgctggaggacctcctagtgctgctacagaaacaggat
gagaagctattgctgaagtgccacagcaagactgctgtgggctcctcagacagcaagcag
accttcagccccgtgctcaagctcaatgctgtgctcatccgctctgtggccacagataaa
cgggccttcttcatcatctgcacctccaagctgggcccaccccagatctatgagctggtt
gcattgacgtcatcagacaagaacacatggatggagctcttagaagaggccgtgcggaat
gccaccaggcaccccggagctgccccaatgcccgtccatcctccacccccaggtccccgg
gagccagcccagcagggccccacacccagcagggtagaactggatgactcagacgtgttc
catggtgaacctgaacctgaggagctgcctggaggcactgggtcccagcagagggtccaa
gggaagcaccaggtcctgctagaggaccctgagcaggagggcagtgcagaggaagaggaa
ctgggtgtcctgccttgcccttccacatccctggatggagagaacaggggcatcaggaca
aggaaccccatccacttggccttcccaggccctctgttcatggaagggctcgctgactcc
gctctggaagatgtggagaacctgcgacatctgatcctgtggagcctgctgccaggtcac
accatggaaactcaggctgcccaggagcccgaggacgacctgacacccacaccttctgtc
atcagcgtcacctctcacccctgggacccaggctccccagggcaagcaccccctgggggt
gaaggggacaacacccagcttgcagggctggagggggaacggccagagcaggaagacatg
ggtctctgttctctggaacacctacccccaaggaccagaaattctgggatatgggagtct
ccagaactggacaggaatctggctgaagatgcttcaagcacagaggcagcaggaggttac
aaagttgtgagaaaagctgaggtggcaggcagcaaggttgtccctgcactaccagagagt
ggccagtcagagcctgggccacctgaagtggaaggcggaacaaaggctacggggaactgc
ttttatgtcagcatgccatcaggacccccggactcaagcaccgaccactcagaggcaccc
atgagcccccctcagcctgacagcctccctgcagggcagacagagcctcagcctcagctg
cagggaggcaacgatgatccaagacgccccagccgctctcctccaagcctggccctcagg
gacgtgggcatgatcttccataccattgagcagctcactctcaagctcaacaggctcaag
gatatggagctggcccacagagagctgctcaagtcccttgggggagagtcatctggtggc
accacgcctgtgggcagtttccacacagaagcagctagatggacagatggctccctctca
cctcccgctaaggagcccctagcttctgactccaggaacagccatgaactggggccctgc
cctgaggatggctctgacgcccccctggaagacagcacagcagacgcagccgcgtcacca
ggaccataa

DBGET integrated database retrieval system